Recombinant Pinus taeda Casparian strip membrane protein 1

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of CASP1 in Pinus taeda

CASP1 belongs to the CASPARIAN STRIP MEMBRANE DOMAIN PROTEIN family, which forms a membrane scaffold to direct lignin deposition at the Casparian strip . Key features include:

  • Structure: Four transmembrane domains with extracellular loops (EL1 and EL2) .

  • Function: Acts as a spatial scaffold to recruit lignin-polymerizing enzymes (e.g., peroxidases) .

  • Conservation: The EL1 domain in euphyllophytes (including gymnosperms like P. taeda) contains a conserved motif absent in plants lacking Casparian strips .

Table 1: Comparative Features of CASP Homologs

FeaturePinus taeda (Predicted)Arabidopsis thaliana (CASP1)Marchantia polymorpha (CASPL)
Transmembrane domains444
EL1 conservationYes (euphyllophyte motif)YesNo
Role in lignin depositionPresumed scaffoldConfirmed scaffold Not determined

Evolutionary Context

CASPs are evolutionarily linked to MARVEL domain proteins, with homologs identified in land plants and green algae . In P. taeda, CASP1 likely diverged from ancestral CASPLs (Casparian strip protein-like) through lineage-specific adaptations:

  • Phylogenetic distribution: CASPs with EL1 signatures correlate with Casparian strip presence in vascular plants .

  • Loss in parasites: Obligate parasites like Utricularia gibba lack EL1 conservation, consistent with reduced root systems .

Functional Insights from Recombinant Studies

While recombinant P. taeda CASP1 has not been explicitly studied, data from Arabidopsis and other plants suggest:

  • Membrane scaffolding: CASP1 forms stable membrane domains that restrict protein diffusion and guide lignin polymerization .

  • Extracellular loop dispensability: Deletion of EL1 or EL2 in Arabidopsis CASP1 does not prevent localization to the Casparian strip domain, implying transmembrane domains are sufficient for scaffolding .

  • Interactions: CASPs recruit peroxidases (e.g., PER64) and dirigent proteins (e.g., ESB1) to ensure localized lignin deposition .

Table 2: Key Interactions in Casparian Strip Formation

ProteinRole in Casparian StripInteraction with CASP1
ESB1 (dirigent protein)Ensures lignin coalescenceRequires CASP1 for localization
PER64 (peroxidase)Catalyzes lignin polymerizationRecruited via CASP1 scaffold
RBOHF (NADPH oxidase)Generates ROS for monolignol activationColocalizes with CASP1

Expression and Localization

In Arabidopsis, CASP1 expression is restricted to the endodermis and regulated by transcription factors (e.g., MYB36) and receptor-like kinases (e.g., SGN3) . P. taeda CASP1 is predicted to exhibit similar tissue specificity, though empirical validation is needed.

Research Gaps and Future Directions

  • Structural studies: No high-resolution structures exist for any CASP protein.

  • Functional validation: Heterologous expression of recombinant P. taeda CASP1 in model systems (e.g., Arabidopsis casp mutants) could clarify its role in lignin patterning.

  • Evolutionary divergence: Why do gymnosperms like P. taeda retain CASP1 despite lacking the SGN3-mediated regulatory network present in angiosperms ?

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Casparian strip membrane protein 1; PtCASP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Pinus taeda (Loblolly pine)
Target Protein Sequence
MKAESGSADAKLPLPPPVGRKRRGLAILDFLLRLLAIGATLSAAIAMGTNNETLKFFTQF FQFNARFYNLSAFIYFVIANATVGLYLLLSLPFSIFDIVRPRAAAFRVLLIFFDTVMVAV CTSGAAAATAIMYVARRGNTKTNWFSICQQFNSFCDQATGALGASFAAVVLLILLVLLSA STLHRQRADF
Uniprot No.

Target Background

Function

Recombinant Pinus taeda Casparian strip membrane protein 1 regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for establishing the Casparian strip membrane domain (CSD) and subsequent Casparian strip formation. The Casparian strip, a cell wall modification in the root endodermis, acts as an apoplastic barrier, preventing lateral diffusion between the intraorganismal and extraorganismal apoplasm.

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pinus taeda Casparian strip membrane protein 1 and its function in plant physiology?

Pinus taeda CASP1 is a four-membrane-span protein that belongs to the CASPARIAN STRIP MEMBRANE DOMAIN PROTEIN family. Similar to other CASP proteins, it functions as a critical component in forming the Casparian strip (CS), which is an impregnation of endodermal cell walls that creates an apoplastic diffusion barrier in roots . This barrier forces symplastic and selective transport of nutrients across the endodermis, providing essential protection to vascular tissues .

The protein serves as a scaffold that helps to establish local lignin deposition by recruiting enzymes involved in lignin polymerization. In functional terms, CASP1 initially localizes throughout the plasma membrane before being removed from lateral membranes to remain exclusively at the Casparian strip membrane domain (CSD), where it exhibits remarkably low turnover . This precise localization is crucial for guiding the formation of the hydrophobic CS barrier that helps defend against various environmental stresses .

How does the molecular structure of Pinus taeda CASP1 compare to those in model plants like Arabidopsis?

The molecular structure of Pinus taeda CASP1 shares significant homology with CASP proteins from model plants like Arabidopsis, reflecting evolutionary conservation of this protein family across plant species that develop Casparian strips. Both contain four transmembrane domains with two extracellular loops (EL1 and EL2) .

Comparative analysis shows that the transmembrane domains contain the most highly conserved residues, suggesting their crucial role in protein function . Particularly significant is the conservation of the EL1 signature, which appears to correlate directly with the ability to form Casparian strips across different plant species . This signature is notably present in gymnosperms like Pinus taeda as well as in angiosperms that form Casparian strips.

The cytoplasmic N-terminal and C-terminal regions show greater sequence divergence between Pinus taeda and Arabidopsis CASP1, which may reflect species-specific regulatory mechanisms while maintaining core functional domains.

What expression patterns characterize CASP1 in Pinus taeda root tissues?

Based on studies of CASP expression in various plant species, Pinus taeda CASP1 likely exhibits tissue-specific expression patterns similar to those observed in other plants with Casparian strips. In Arabidopsis, CASP1 expression is specifically detected in endodermal cells that directly contact the stele . The expression typically begins in the differentiation zone of the root, corresponding to where Casparian strip formation initiates.

In more complex root systems like tomato (which may resemble the complexity of pine roots better than Arabidopsis), CASP1 maintains this endodermis-specific expression pattern . The spatiotemporal expression of CASP1 in Pinus taeda would likely follow this conserved pattern, with expression beginning at a specific distance from the root tip, coinciding with the onset of endodermal differentiation.

When studying Pinus taeda CASP1 expression, researchers should employ techniques such as in situ hybridization or promoter-reporter fusions (if working with transgenic material) to precisely map the expression domains within the complex gymnosperm root architecture.

What methods are most effective for isolating and purifying recombinant Pinus taeda CASP1?

Isolating and purifying recombinant Pinus taeda CASP1 presents challenges due to its multiple transmembrane domains. The following methodological approach is recommended:

  • Expression system selection: Use eukaryotic expression systems such as insect cells (Sf9 or High Five) or yeast (Pichia pastoris) rather than prokaryotic systems, as they provide better membrane protein folding machinery.

  • Construct design: Include a cleavable affinity tag (His6 or FLAG) at either the N-terminus or C-terminus, avoiding disruption of transmembrane domains. Consider adding a fluorescent protein fusion (e.g., GFP) to monitor expression and localization.

  • Solubilization: Extract the protein using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin to maintain protein structure.

  • Purification protocol:

    • Initial capture using affinity chromatography (Ni-NTA for His-tagged proteins)

    • Secondary purification using size exclusion chromatography

    • Optional ion exchange chromatography for higher purity

  • Quality assessment: Verify protein integrity using SDS-PAGE, Western blotting, and circular dichroism for secondary structure confirmation.

When expressing CASP1, researchers should note that proper localization of CASP proteins in their native context requires their stable incorporation into a membrane domain . Therefore, maintaining the structural integrity of the transmembrane domains during recombinant expression is critical.

How can researchers verify the functionality of recombinant Pinus taeda CASP1?

Verifying the functionality of recombinant Pinus taeda CASP1 requires multiple approaches to assess both its structural integrity and functional capacity:

  • Membrane integration assay: Confirm proper insertion into membranes using protease protection assays or membrane fractionation techniques.

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with known CASP1 interactors (such as peroxidases)

    • Surface plasmon resonance to measure binding kinetics to partner proteins

    • Yeast two-hybrid or split-ubiquitin assays for membrane protein interactions

  • Heterologous expression in model plants:

    • Express Pinus taeda CASP1 in Arabidopsis casp1 mutants to test for functional complementation

    • Fluorescent tagging to verify correct localization to the Casparian strip domain

    • Evaluate rescue of the barrier function using apoplastic tracer assays

  • In vitro lignification assay: Assess the ability of purified CASP1 to enhance lignin polymerization in reconstituted systems containing peroxidases and monolignols.

  • Structural integrity verification:

    • Circular dichroism to confirm proper secondary structure

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to evaluate protein stability

Studies have shown that when expressed in heterologous systems, functional CASP proteins should be able to integrate into the CASP membrane domain, suggesting a conserved propensity to form transmembrane scaffolds . This property can be leveraged as a key functional assay.

What expression systems are optimal for producing functional recombinant Pinus taeda CASP1?

The optimal expression systems for producing functional recombinant Pinus taeda CASP1 depend on the experimental goals and required protein authenticity:

  • Plant-based expression systems:

    • Advantages: Native post-translational modifications, proper membrane insertion

    • Methodologies: Agroinfiltration in Nicotiana benthamiana, stable transformation of Arabidopsis cell cultures

    • Protocol considerations: Use inducible promoters to control expression timing; co-express with chaperones if needed

  • Insect cell expression system:

    • Advantages: High yield, eukaryotic processing, suitable for membrane proteins

    • Cell lines: Sf9 or High Five cells using baculovirus vectors

    • Optimization strategies: Adjust multiplicity of infection (MOI), harvest timing, and temperature

  • Yeast expression systems:

    • Advantages: Cost-effective, scalable, post-translational modifications

    • Recommended species: Pichia pastoris for membrane proteins

    • Methodological considerations: Use methanol-inducible promoters, optimize induction conditions

  • Cell-free expression systems:

    • Advantages: Rapid, allows toxic protein expression, direct incorporation into nanodiscs or liposomes

    • Technical approach: Use wheat germ or insect cell extracts supplemented with microsomes

When selecting an expression system, researchers should consider that CASP proteins show high stability in their membrane domain and act as scaffolds . Therefore, expression systems that support proper membrane insertion and scaffold formation are preferable.

Expression SystemAdvantagesLimitationsYieldAuthenticity
Plant-basedNative folding, PTMsLower yieldLow-MediumVery High
Insect cellsHigh yield, eukaryotic processingComplex setupHighHigh
YeastCost-effective, scalableMay have different glycosylationMedium-HighMedium
Cell-freeRapid, controllableExpensive, lower yieldLowMedium

What structural domains of Pinus taeda CASP1 are critical for its integration into the Casparian strip membrane domain?

The critical structural domains of Pinus taeda CASP1 for Casparian strip membrane domain integration include:

  • Transmembrane domains: Research on CASP proteins indicates that the four transmembrane domains are crucial for proper localization and scaffold formation . The conserved residues within these domains likely mediate protein-protein interactions necessary for CASP oligomerization.

  • Extracellular Loop 1 (EL1): This domain contains a signature sequence that correlates with the ability to form Casparian strips . Experimental evidence suggests that this domain is evolutionarily conserved specifically in plants that develop Casparian strips, indicating its functional importance.

  • Cytoplasmic regions: The N-terminal and C-terminal regions may contain motifs for interactions with cytosolic proteins involved in lignin polymerization machinery.

To study these domains, researchers should employ:

  • Deletion analysis: Systematically remove domains to identify essential regions

  • Domain swapping: Exchange domains with other CASP family members to identify specificity determinants

  • Site-directed mutagenesis: Target conserved residues within transmembrane domains

  • Topology mapping: Use protease protection assays or glycosylation site insertion to verify membrane orientation

Experiments have shown that when certain CASP/CASPL proteins are ectopically expressed in the endodermis, they can integrate into the CASP membrane domain, suggesting shared structural features that enable scaffold formation . Notably, studies have demonstrated that extracellular loops are not absolutely necessary for generating the scaffold, as CASP1 was still able to localize correctly when either extracellular loop was deleted .

How do environmental stressors affect the expression and function of Pinus taeda CASP1?

Environmental stressors can significantly impact the expression and function of Casparian strip proteins, including Pinus taeda CASP1. While specific data for pine is limited, studies in other plants provide methodological insights:

  • Salt stress response:

    • Expression changes: Monitor CASP1 transcript and protein levels under controlled salt conditions using qRT-PCR and Western blotting

    • Functional assessment: Examine changes in Casparian strip integrity using apoplastic tracer dyes

    • Physiological consequences: Measure ion accumulation in stele tissues to assess barrier function

  • Drought stress effects:

    • Adaptive responses: Analyze promoter elements for drought-responsive motifs

    • Methodological approach: Use split-root systems to apply differential water treatments

    • Quantification: Correlate CASP1 expression with hydraulic conductivity measurements

  • Heavy metal exposure:

    • Expression analysis: Use dose-response experiments with various heavy metals

    • Localization changes: Monitor potential alterations in CASP1 protein distribution using fluorescent fusion proteins

    • Barrier integrity: Assess changes in metal ion penetration into vascular tissues

  • Temperature stress protocols:

    • Cold acclimation: Gradual temperature reduction with timed sampling

    • Heat stress: Short-term and long-term exposure regimes

    • Recovery dynamics: Analyze CASP1 expression patterns during stress recovery periods

The Casparian strip has been shown to help defend against various environmental stresses , making this an important area of investigation for Pinus taeda CASP1 function, particularly in the context of climate change impacts on forest ecosystems.

How does the evolutionary conservation of CASP1 in gymnosperms like Pinus taeda compare to angiosperms?

The evolutionary conservation of CASP1 between gymnosperms and angiosperms reveals important insights about the fundamental nature of Casparian strip formation:

  • Phylogenetic analysis: CASP proteins form a distinct clade within the larger CASPL family that spans all major land plant divisions . Gymnosperms like Pinus taeda possess CASP homologs that cluster with angiosperm CASPs, suggesting conservation of function despite over 300 million years of independent evolution.

  • Signature sequence conservation: The extracellular loop 1 (EL1) signature appears to be highly conserved specifically in plants that form Casparian strips, regardless of their evolutionary position . This signature is present in gymnosperms, supporting its fundamental role in CASP function.

  • Functional domain retention: Transmembrane domains show the highest sequence conservation between gymnosperm and angiosperm CASPs, indicating their critical functional importance .

  • Methodological approaches for comparative studies:

    • Sequence alignment and motif analysis of CASP proteins across species

    • Heterologous expression of gymnosperm CASPs in angiosperm model systems

    • Cross-species complementation assays to test functional conservation

The presence of a conserved EL1 signature in plants that form Casparian strips, and its absence in plants that lack Casparian strips (like certain algae), provides strong evidence for the ancient evolutionary origin of this mechanism . Interestingly, even parasitic plants like Striga asiatica, which have modified root anatomy, retain a CASP homolog with a perfectly conserved EL1 signature , further highlighting the fundamental importance of this protein family.

What methodological approaches can be used to study the temporal dynamics of CASP1 assembly in Pinus taeda root endodermis?

Studying the temporal dynamics of CASP1 assembly in Pinus taeda root endodermis requires sophisticated imaging and molecular techniques:

  • Live imaging approaches:

    • Fluorescent protein fusions: Generate transgenic pine lines expressing CASP1-GFP fusions

    • Light-sheet microscopy: Enable minimally invasive 4D imaging of living roots

    • Spinning disk confocal microscopy: Provide high-speed acquisition for dynamic processes

    • Methodological challenge: Pine root thickness requires specialized clearing techniques

  • Inducible expression systems:

    • Heat-shock or chemical-inducible promoters: Control the timing of CASP1 expression

    • Photoactivatable fluorescent proteins: Enable precise spatiotemporal activation

    • Single-cell resolution analysis: Track protein movement from synthesis to final localization

  • Electron microscopy techniques:

    • Correlative light and electron microscopy (CLEM): Combine fluorescence with ultrastructural analysis

    • Immunogold labeling: Precisely localize CASP1 during assembly stages

    • Sample preparation challenge: Develop fixation protocols that preserve both protein localization and ultrastructure

  • Molecular interaction timelines:

    • Proximity labeling techniques: Use APEX2 or BioID fusions to identify temporal interaction partners

    • FRET/FLIM analysis: Measure real-time interactions between CASP1 and other proteins

    • Co-immunoprecipitation time series: Track changing protein complexes during assembly

Studies in Arabidopsis have shown that CASP proteins initially localize throughout the plasma membrane before being quickly removed from lateral membranes to remain exclusively at the Casparian strip domain . This dynamic process is likely conserved in pine, though the thicker root structure may present methodological challenges for observation.

A significant technical challenge is that methods used for Arabidopsis roots may not be feasible for thicker pine roots . Previous studies using clearing methods have shown that only epidermis and exodermis were clearly visible in longitudinal sections, with Casparian strips being detected only in cross sections .

What gene editing approaches could be used to study Pinus taeda CASP1 function in vivo?

  • CRISPR/Cas9 system adaptation:

    • Delivery methods: Optimize Agrobacterium-mediated transformation or biolistic delivery for pine embryogenic tissue

    • Guide RNA design: Target conserved regions of CASP1 using multiple gRNAs

    • Selection strategy: Develop efficient selection markers for transformed pine cells

    • Methodological considerations: Use tissue-specific or inducible promoters to limit editing to root tissues

  • RNAi-based approaches:

    • Hairpin construct design: Target unique regions of Pinus taeda CASP1

    • Vector selection: Optimize for gymnosperm transformation

    • Validation techniques: qRT-PCR and Western blotting to confirm knockdown efficiency

    • Phenotypic analysis: Examine Casparian strip integrity using apoplastic tracers

  • Hairy root transformation systems:

    • Advantage: Faster than whole-plant transformation

    • Protocol adaptation: Modify Agrobacterium rhizogenes methods for pine seedlings

    • Analysis workflow: Direct examination of transgenic roots for CASP1 function

  • Heterologous systems for functional studies:

    • Arabidopsis as surrogate: Express pine CASP1 variants in Arabidopsis casp mutants

    • Xenopus oocytes: Study membrane domain formation properties

    • Yeast expression: Analyze protein trafficking and localization

These approaches should be supported by physiological analyses to connect molecular changes to root function, including measurement of nutrient uptake selectivity, hydraulic conductivity, and response to environmental stressors.

How do protein-protein interactions govern Pinus taeda CASP1 function in Casparian strip formation?

Understanding the protein-protein interactions that govern Pinus taeda CASP1 function requires systematic investigation of its interaction network:

  • Identification of interaction partners:

    • Co-immunoprecipitation with mass spectrometry: Identify proteins that physically associate with CASP1

    • Yeast two-hybrid screening: Identify binary interactions, particularly for non-transmembrane domains

    • Proximity labeling techniques: BioID or APEX2 fusions to identify neighborhood proteins

    • Methodological considerations: Compare interactions in normal versus stress conditions

  • Characterization of the CASP1 interactome:

    • Interaction with lignin biosynthesis enzymes: Focus on peroxidases similar to PER64 in Arabidopsis

    • NADPH oxidases: Examine interactions with RBOHF homologs

    • Other CASP family members: Investigate heteromerization potential

    • Receptor-like kinases: Look for interactions with SGN1 and SGN3 homologs

  • Functional validation of interactions:

    • Mutational analysis: Identify interaction interfaces through site-directed mutagenesis

    • Competition assays: Use peptides or protein fragments to disrupt specific interactions

    • In vitro reconstitution: Assemble minimal protein complexes to define functional units

  • Spatiotemporal dynamics:

    • FRET/FLIM analysis: Measure real-time interactions in living cells

    • Super-resolution microscopy: Map precise locations of protein complexes

    • Time-course studies: Track changes in interaction networks during development

Based on studies in Arabidopsis, the CASP proteins likely form a local scaffold that recruits a set of enzymes including RBOHF, PER64, and ESB1 . These interactions are critical for the local lignin polymerization necessary for Casparian strip formation. Additionally, the precise localization of CASPs is under the control of receptor-like kinases SGN1 and SGN3 , suggesting a complex regulatory network.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.