Recombinant Pinus taeda Cytochrome P450 704C1 (CYP704C1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pinus taeda Cytochrome P450 704C1 (CYP704C1)

Cytochrome P450s (CYPs) are a superfamily of enzymes that play crucial roles in the metabolism of various compounds, including those involved in plant defense and biosynthesis . CYP704C1, a specific member of this superfamily found in Pinus taeda (Loblolly pine), is involved in various metabolic processes . These enzymes are responsible for detoxification of molecules in both animals and plants .

Identification and Characterization

The identification and characterization of CYP450 genes, such as CYP704C1, involve several steps:

  • Transcriptome Analysis Full-length transcriptome analysis helps in discovering CYP450 genes, including those belonging to various families and subfamilies .

  • Bioinformatic Tools Various bioinformatic tools are used to analyze the CYP450 superfamily genes, including their nomenclature, evolution, structure, and expression patterns . Tools like NCBI's BLASTx are used to manually examine potential CYP sequences .

  • Sequence Analysis Open reading frame (ORF) sequences of CYPs are identified using ORF Finder, and the nucleotide sequences of the ORF are translated into amino acid sequences using tools like the ExPASY translation tool .

  • Phylogenetic Analysis Phylogenetic trees are created using software like MEGA to understand the evolutionary relationships of CYP704C1 with other known plant CYPs .

Function and Role

CYP704C1, like other cytochrome P450s, functions as monooxygenases, catalyzing the incorporation of one atom of oxygen into a substrate . The other oxygen atom is reduced to water. These enzymes are involved in a wide array of metabolic pathways, including:

  • Biosynthesis of natural products CYPs are crucial in the biosynthesis of various natural products in plants .

  • Herbicide Resistance Some CYP450s play essential roles in metabolism-based multiple herbicide resistance .

  • Xenobiotic Metabolism Certain CYPs, like CYP76B1, metabolize a wide range of xenobiotics, including herbicides, and can detoxify foreign compounds .

Experimental Techniques

Research on CYP704C1 and other CYP450s involves various experimental techniques:

  • Yeast Expression Systems Expressing CYP750B1 in Saccharomyces cerevisiae BY4741 cells to study monoterpene hydroxylation .

  • Agrobacterium-mediated Transformation Recombinant plasmids are transformed into plants like N. benthamiana using Agrobacterium tumefaciens-mediated transient transformation systems to assess subcellular localization .

  • Enzyme Assays Enzyme assays with tissue extracts help in characterizing the function of CYP450s .

Data Tables and Analysis

Data tables are essential for summarizing study characteristics and comparing elements across different studies . These tables often include:

Gene NameProteinIsoelectric PointMolecular WeightSubcellular LocalizationExpression Level
CYP704C1(Values)(Values)(Values)(Location)(Values)

Relevant research findings

  • CYP750B1 in Thujone Biosynthesis CYP750B1 catalyzes the hydroxylation of (+)-sabinene to trans-sabin-3-ol in thujone biosynthesis in Western Redcedar .

  • CYP76B1 in Xenobiotic Metabolism CYP76B1 is strongly induced by foreign compounds and metabolizes xenobiotics, including phenylurea herbicides .

  • CYP450s in Steroidal Alkaloid Biosynthesis CYP450 genes play essential roles in regulating steroidal alkaloids biosynthesis .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize fulfilling your request.
Synonyms
CYP704C1; Cytochrome P450 704C1; Cytochrome P450 CYPD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-518
Protein Length
full length protein
Species
Pinus taeda (Loblolly pine)
Target Names
CYP704C1
Target Protein Sequence
MDVNILTMFVTVSALALACSLWIASYLRNWRKKGVYPPVVGTMLNHAINFERLHDYHTDQ AQRYKTFRVVYPTCSYVFTTDPVNVEHILKTNFANYDKGTFNYDIMKDLLGDGIFNVDGD KWRQQRKLASSEFASKVLKDFSSGVFCNNAAKLANILAQAAKLNLSVEMQDLFMRSSLDS ICKVVFGIDINSLSSSKAESGPEASFAKAFDVANAMVFHRHMVGSFWKVQRFFNVGSEAI LRDNIKMVDDFLYKVIHFRRQEMFSAEKENVRPDILSRYIIISDKETDGKVSDKYLRDVI LNFMVAARDTTAIALSWFIYMLCKHQHVQEKLLEEIISSTSVHEDQYSTECNDIASFAQS LTDEALGKMHYLHASLSETLRLYPALPVDGKYVVNEDTLPDGFKVKKGDSVNFLPYAMGR MSYLWGDDAKEFKPERWIQDGIFHPKSPFKFPAFQAGPRTCLGKDFAYLQMKIVAAVLVR FFKFEAVKTKEVRYRTMLTLHMNEDGLNVQVTPRLNSD
Uniprot No.

Target Background

Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are suitable for producing recombinant CYP704C1?

Multiple expression systems can be employed for recombinant CYP704C1 production, each with distinct advantages:

The choice of expression system should be based on research objectives, desired protein yield, and downstream applications.

What methods are most effective for isolating and identifying novel CYP450 genes in conifers?

The identification of conifer CYP450 genes like CYP704C1 requires multiple complementary approaches:

  • EST database mining: P450 candidate genes can be identified by searching conifer EST databases using known P450 sequences as queries. For loblolly pine, researchers conducted BLAST searches using Arabidopsis thaliana P450 sequences as references to identify novel P450 genes including CYP704C1 .

  • RACE and full-length cDNA cloning: To recover complete coding sequences, rapid amplification of cDNA ends (RACE) techniques are essential. For CYP704C1 isolation, RACE was used to identify 5'-end sequences, and full-length cDNAs were amplified using gene-specific primers and high-fidelity polymerases like Pfu .

  • RNA isolation optimization: For conifers, RNA extraction often requires specialized protocols. Effective RNA isolation has been achieved from tissues harvested after treatment with elicitors like methyl jasmonate, which induces expression of defense-related genes including some P450s .

  • PCR primer design: Designing specific primers based on conserved regions of P450 subfamilies improves amplification success. For CYP704C1, specific oligonucleotide primers were designed to target unique regions of the sequence .

  • Transcriptome sequencing: Full-length transcriptome analysis using platforms like PacBio can reveal comprehensive CYP450 profiles, as demonstrated in studies of other plants like Fritillaria cirrhosa .

What are the optimal storage and handling conditions for recombinant CYP704C1?

Proper storage and handling of recombinant CYP704C1 is critical for maintaining protein integrity and enzymatic activity:

  • Storage temperature: Store recombinant CYP704C1 at -20°C to -80°C for long-term preservation. Working aliquots can be kept at 4°C for up to one week .

  • Aliquoting strategy: Upon receipt, the protein should be aliquoted to avoid repeated freeze-thaw cycles, which can significantly reduce enzyme activity .

  • Reconstitution protocol: Prior to opening, the vial should be briefly centrifuged to bring contents to the bottom. Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Buffer composition: Optimal stability has been observed with Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . Trehalose serves as a cryoprotectant that helps maintain protein structure during freeze-thaw cycles.

  • Handling precautions: When working with the lyophilized powder form, care should be taken to minimize exposure to moisture. For reconstituted protein, maintain sterile conditions to prevent microbial contamination.

What approaches can be used to determine the substrate specificity of CYP704C1?

Determining substrate specificity of CYP704C1 requires systematic experimental approaches:

  • In vitro enzyme assays: Purified recombinant CYP704C1 can be incubated with potential substrates in the presence of appropriate cofactors (NADPH, cytochrome P450 reductase). Similar approaches were used for characterizing PtAO (CYP720B1), which was found to oxidize multiple diterpenoid substrates with Km values of 0.5-5.3 μM .

  • Metabolite profiling: LC-MS/MS analysis of reaction products enables identification of substrate conversion and product formation. For comprehensive analysis, both targeted and untargeted metabolomics approaches can be employed.

  • Comparative analysis with related P450s: Phylogenetic analysis can reveal relationships with functionally characterized P450s, providing insights into potential substrate preferences. The neighbor-joining method with MEGA software using the Jones-Taylor-Thornton model has been effective for analyzing evolutionary relationships among CYP450 family members .

  • In vivo reconstitution in heterologous systems: Expression of CYP704C1 in heterologous systems like yeast alongside appropriate substrate-producing enzymes can reveal functional activities, as demonstrated for PtAO which catalyzed in vivo oxidations when expressed in yeast .

  • Structure-based computational modeling: Homology modeling and molecular docking studies can predict substrate binding sites and potential substrate preferences based on the protein's structural features.

What techniques can be used to study the subcellular localization of CYP704C1?

Understanding the subcellular localization of CYP704C1 is crucial for interpreting its physiological function:

How can researchers overcome challenges in expressing functional P450 enzymes like CYP704C1?

P450 enzymes present unique challenges for heterologous expression:

  • Codon optimization: Adjusting the codon usage to match the expression host can significantly improve protein yields. For E. coli expression of conifer P450s, optimization of rare codons is particularly important.

  • N-terminal modifications: P450 enzymes typically contain hydrophobic membrane-binding domains that can hinder expression. Strategic modifications such as N-terminal truncations or fusion with solubilizing tags (e.g., His-tag as used for recombinant CYP704C1 ) can improve expression and solubility.

  • Co-expression with redox partners: For functional studies, co-expression with appropriate electron transport partners (cytochrome P450 reductase and potentially cytochrome b5) may be necessary to achieve proper enzymatic activity.

  • Expression temperature optimization: Lower induction temperatures (16-20°C) often improve the folding and activity of recombinant P450 enzymes compared to standard expression protocols.

  • Membrane mimetics: Addition of detergents, lipids, or nanodiscs can provide a suitable environment for membrane-associated P450s, improving stability and activity.

How can functional genomics approaches be used to study CYP704C1's role in pine metabolism?

Functional genomics provides powerful tools for understanding CYP704C1's physiological role:

  • RNA interference (RNAi) or CRISPR-based gene editing: While challenging in conifers, these approaches can be used to downregulate or knock out CYP704C1 expression to observe resultant metabolic changes. This requires efficient transformation protocols for pine species.

  • Correlation of gene expression with metabolite profiles: Quantitative PCR analysis of CYP704C1 expression across tissues, developmental stages, or in response to stress treatments can be correlated with changes in metabolite levels, particularly terpenoids .

  • Co-expression network analysis: Transcriptomic data can reveal genes whose expression patterns correlate with CYP704C1, potentially identifying functionally related genes in the same metabolic pathway. This approach has been successfully applied to identify candidate CYP450s involved in isosteroidal alkaloid biosynthesis in other plants .

  • Heterologous pathway reconstitution: CYP704C1 can be expressed in model systems alongside other enzymes in a hypothesized pathway to test functional interactions and metabolic roles.

  • Induction studies: Exposure of pine tissues to elicitors like methyl jasmonate, followed by RNA isolation and qPCR analysis, can reveal if CYP704C1 is induced under defense-related conditions, suggesting a role in defense metabolism .

What analytical methods are most appropriate for characterizing CYP704C1 enzymatic products?

Sophisticated analytical techniques are essential for identifying and quantifying CYP704C1 reaction products:

  • Liquid chromatography-mass spectrometry (LC-MS): High-resolution LC-MS/MS enables the identification of oxidized terpenoid products, particularly those with hydroxyl or carbonyl modifications characteristic of P450-catalyzed reactions.

  • Gas chromatography-mass spectrometry (GC-MS): For volatile or derivatizable products, GC-MS provides excellent separation and structural information.

  • Nuclear magnetic resonance (NMR) spectroscopy: For complete structural elucidation, especially for novel metabolites, 1D and 2D NMR techniques are essential to determine the exact positions of modifications introduced by CYP704C1.

  • Enzyme kinetics analysis: Steady-state kinetics measurements using purified recombinant enzyme can determine key parameters like Km and kcat for various substrates, as was done for the related PtAO enzyme which showed Km values of 0.5-5.3 μM for different diterpenoid substrates .

  • Isotope labeling: Incorporation of stable isotopes (13C, 18O) into substrates or cofactors can help track the fate of specific atoms during the reaction, providing mechanistic insights.

How does CYP704C1 compare to other P450 enzymes in the CYP704 family?

The CYP704 family represents an important group of plant P450 enzymes with diverse functions:

CYP EnzymeOrganismSequence Similarity to CYP704C1Known FunctionExpression Pattern
CYP704C1Pinus taeda100% (reference)Not fully characterized, potentially involved in diterpenoid metabolism Identified in loblolly pine EST database
CYP704B1Arabidopsis thalianaModerate similarity (exact % not in search results)Fatty acid hydroxylation involved in pollen exine developmentPredominantly expressed in anthers
CYP704 family membersVarious plantsVarying degrees of similarityRoles in both primary metabolism (fatty acid hydroxylation) and specialized metabolismTissue-specific expression patterns

While specific functional data for CYP704C1 is limited in the search results, phylogenetic analysis of the CYP704 family suggests potential roles in either fatty acid metabolism or specialized metabolism related to diterpenoid biosynthesis .

What is the potential role of CYP704C1 in conifer defense mechanisms?

Conifers rely on complex terpenoid metabolic networks for defense against pathogens and herbivores:

  • Terpenoid resin acid biosynthesis: CYP704C1 may be involved in the biosynthesis or modification of diterpenoid resin acids (DRAs), which are important defense compounds in conifers. It was identified alongside other P450s during efforts to discover enzymes involved in DRA biosynthesis .

  • Induction patterns: While not specifically documented for CYP704C1, related conifer P450s show induction by methyl jasmonate (MJ), a plant hormone involved in defense signaling. For example, PtAO (CYP720B1) was identified as an MJ-inducible P450 that contributes to oxidative diversification of diterpenoid defense compounds in loblolly pine .

  • Metabolic network position: Based on its classification and identification context, CYP704C1 may function in late-stage modifications of terpenoid structures, potentially introducing functional groups that influence biological activity against pests or pathogens.

  • Evolutionary implications: Phylogenetic analysis of CYP704C1 in relation to other conifer P450s could reveal its position in the evolutionary history of specialized metabolism in gymnosperms, providing insights into the development of defense mechanisms.

What are the key unanswered questions about CYP704C1 function and regulation?

Several important aspects of CYP704C1 biology remain to be elucidated:

  • Precise substrate specificity: The exact natural substrates of CYP704C1 remain unknown. Systematic screening with various terpenoids and other potential substrates is needed to determine its biochemical function.

  • Reaction mechanism: The specific oxidation reactions catalyzed by CYP704C1 (hydroxylation, epoxidation, etc.) and their regioselectivity and stereoselectivity need investigation.

  • Transcriptional regulation: The promoter elements controlling CYP704C1 expression and their responses to developmental and environmental signals require characterization.

  • Post-translational regulation: Potential mechanisms of activity regulation through protein modifications or protein-protein interactions remain unexplored.

  • Physiological consequences: The effects of CYP704C1 activity on pine physiology, particularly in stress responses and development, need further study.

How might CYP704C1 be utilized in biotechnological applications?

CYP704C1 has potential applications in various biotechnological contexts:

  • Terpenoid engineering: If CYP704C1 catalyzes specific oxidative modifications of terpenoids, it could be employed in engineered microbial or plant systems to produce valuable modified terpenoids for pharmaceutical or industrial applications.

  • Biocatalysis: P450 enzymes can perform regioselective and stereoselective oxidations that are challenging for chemical synthesis. If CYP704C1 shows useful catalytic properties, it could be developed as a biocatalyst for pharmaceutical or fine chemical production.

  • Forest protection strategies: Understanding CYP704C1's role in pine defense metabolism could inform breeding or biotechnological approaches to enhance conifer resistance to pests and pathogens.

  • Conifer metabolic engineering: As part of the growing toolkit for manipulating conifer specialized metabolism, CYP704C1 characterization contributes to our ability to modify valuable traits in economically important tree species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.