Recombinant Pinus taeda Cytochrome P450 720B2 (CYP720B2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
CYP720B2; Cytochrome P450 720B2; Cytochrome P450 CYPB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-487
Protein Length
full length protein
Species
Pinus taeda (Loblolly pine)
Target Names
CYP720B2
Target Protein Sequence
MGSGIMTETLTDSWLVGLLCLVLGFLLLQLYKLVWGASSRAYKLPPGSTGWPLIGETISF FRGINSTAQPRQFIQEREQRYGEIFRSNLFGRSRIVVSVDPEFNKHVLQHEGRQFQANYP KPLRNLIGKYGLLSVHGDLQRKLHGAAVNLLRFERLSVDFMEDIQNLLHITLAKWEAKRD IHLQEECHQLVLNLMAKQLLDLSPSKDTEEICEAFGHFSEALLAVPIKIPGTKYARGFKA REFLIKKIYESIEDRRQHPEAVHNDLLTKLLKEDSFSEEIIADFILFLLFAGHETSSRSM SFAIKFLTDCPRALEELKAEHDALLKRKGNLKNQKLNWDDYQSLKFTQCVIHETLRVGNF GPGVFRETKEDIKTKGGFVIPRGWTVYVFLTGTHLDEKYHSSALKFDPWRWQPHLQDQEL LKNPSFMPFGGGARLCPGMHLAKMELALFLHNFVTKFRWEALQDDKISYFPFPRLIKGLP IRLRLRE
Uniprot No.

Target Background

Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is CYP720B2 and how does it relate functionally to CYP720B1 in Pinus taeda?

    CYP720B2 is a cytochrome P450 monooxygenase identified in loblolly pine (Pinus taeda) that belongs to the CYP720B subfamily. It shares 65% amino acid identity with CYP720B1 (PtAO), which is a well-characterized multifunctional enzyme involved in diterpene resin acid (DRA) biosynthesis .

    While CYP720B1 has been confirmed to catalyze multiple consecutive oxidation steps on various diterpene alcohols and aldehydes, CYP720B2's specific enzymatic functions remain less characterized. Both enzymes show approximately 40% amino acid identity to brassinosteroid hydroxylases (CYP90A1/B1) . The gene encoding CYP720B2 contains an open reading frame with conserved P450 motifs including the characteristic N-terminal membrane-anchoring domain, heme-binding domain, and the absolutely conserved cysteine amino acid that is present in all P450 enzymes .

    Methodologically, when investigating the functional relationship between these enzymes, researchers should consider:

    • Comparative substrate specificity assays using recombinant proteins

    • Gene expression correlation studies in response to stress conditions

    • Phylogenetic analyses to establish evolutionary relationships

  • What experimental approaches can be used to express and purify recombinant CYP720B2?

    Successful expression and purification of recombinant CYP720B2 requires careful consideration of expression systems and optimization steps:

    Expression Systems:

    Expression SystemAdvantagesConsiderations
    E. coliHigh yield, cost-effectiveMay require codon optimization, potential for inclusion bodies
    Yeast (S. cerevisiae)Post-translational modifications, membrane integrationSlower growth rate than bacteria
    BaculovirusNative-like folding, high expression levelsMore complex system, higher cost
    Cell-free expressionRapid production, avoids toxicity issuesLower yield, higher cost

    Methodological approach:

    1. Clone the full-length CYP720B2 cDNA using PCR with gene-specific oligonucleotide primers

    2. Determine ATG start sites by alignment with known plant P450s and according to sequence context characteristic for higher plant start codons

    3. Consider codon optimization for the selected expression system to improve yield

    4. For E. coli expression, use IPTG-inducible systems like pET vectors or Gateway-compatible systems

    5. For yeast expression, vectors like pYES-DEST52 have been successfully used for other conifer P450s

    6. Include appropriate affinity tags (His-tag is commonly used) for purification

    7. Verify expression by immunoblot analysis

    8. Confirm functional activity through reduced CO difference spectra (expect Soret peak at approximately 448 nm)

    Note that researchers have reported difficulties detecting CYP720B2 expression in certain systems while successfully expressing CYP720B1 , suggesting optimization may be required.

  • How can researchers confirm the functional activity of recombinant CYP720B2?

    Confirming functional activity of CYP720B2 requires multiple complementary approaches:

    1. Spectroscopic Analysis:

    • Measure the reduced CO difference spectrum to confirm proper heme incorporation

    • A characteristic Soret peak at approximately 448 nm indicates correctly folded and active P450 enzyme

    2. In vitro Enzyme Assays:

    • Prepare microsomes from expression systems containing recombinant CYP720B2

    • Include NADPH or an NADPH-regenerating system as cofactor

    • Test with potential substrates such as abietadiene, abietadienol, and abietadienal

    • Analyze reaction products using GC-MS or LC-MS techniques

    3. In vivo Biotransformation Assays:

    • Transform yeast strains with CYP720B2 expression constructs

    • Feed potential substrates to intact cells

    • Extract and analyze metabolites by chromatographic methods

    • Compare profiles with control strains lacking CYP720B2

    4. Activity Parameters to Monitor:

    • pH optimum (expected around 7.5-7.6 based on related enzymes)

    • Temperature optimum (typically 25-30°C for conifer P450s)

    • Linearity of activity over time

    • NADPH dependence

    • Substrate specificity and kinetic parameters

    When CYP720B1 was tested using these methods, it showed strict NADPH dependence and linear activity for at least 12 minutes at 30°C . Similar parameters should be evaluated for CYP720B2.

Intermediate Research Questions

  • How does methyl jasmonate treatment affect CYP720B2 expression in Pinus taeda and what methodologies can be used to study this?

    Methyl jasmonate (MJ) is a plant signaling molecule that induces defense responses in conifers, including upregulation of diterpene resin acid biosynthesis. For CYP720B1, MJ treatment has been shown to induce expression , but CYP720B2-specific responses require further investigation.

    Experimental Approaches:

    1. Quantitative Gene Expression Analysis:

    • Treat Pinus taeda seedlings or cell cultures with MJ (typically 100-200 μM)

    • Collect tissue samples at multiple time points (0, 3, 6, 12, 24, 48, 72 hours)

    • Extract RNA and perform RT-qPCR with gene-specific primers for CYP720B2

    • Use appropriate reference genes for normalization (e.g., actin, ubiquitin)

    • Compare expression levels with untreated controls

    2. Protein-Level Analysis:

    • Extract proteins from MJ-treated and control tissues

    • Perform immunoblot analysis using specific antibodies against CYP720B2

    • Quantify protein levels by densitometry

    3. Metabolite Analysis:

    • Extract and quantify diterpene resin acids from MJ-treated and control tissues

    • Correlate metabolite levels with CYP720B2 expression patterns

    • Use GC-MS or LC-MS for comprehensive profiling

    4. Promoter Analysis:

    • Clone the CYP720B2 promoter region (typically 1-2 kb upstream of the start codon)

    • Identify jasmonate-responsive elements through bioinformatic analysis

    • Perform promoter-reporter fusion assays to validate functional elements

    When studying MJ-induced changes, it's important to distinguish between local and systemic responses and to consider that different tissues (needles, stems, roots) may show differential induction patterns.

  • What approaches can be used to determine the subcellular localization of CYP720B2 and why is this important?

    Subcellular localization is crucial for understanding the functional integration of CYP720B2 in the diterpene resin acid biosynthesis pathway. Research has shown that conifer diterpene synthases (which produce substrates for CYP720 enzymes) are located in plastids, while P450s can be localized to either plastids or the endoplasmic reticulum (ER) .

    Experimental Approaches:

    1. Fluorescent Protein Fusion:

    • Generate CYP720B2-GFP fusion constructs (N- or C-terminal fusions)

    • Express in plant cells (tobacco or pine cell cultures)

    • Visualize using confocal microscopy

    • Co-localize with organelle-specific markers

    2. Immunolocalization:

    • Develop specific antibodies against CYP720B2

    • Perform immunogold labeling for electron microscopy

    • Perform immunofluorescence for confocal microscopy

    3. Subcellular Fractionation:

    • Isolate different cellular compartments (ER, plastids, mitochondria)

    • Detect CYP720B2 by Western blotting

    • Confirm fraction purity using marker proteins

    4. Bioinformatic Prediction:

    • Analyze the N-terminal sequence for targeting peptides

    • Use predictive algorithms for subcellular localization

    Significance of Localization:
    The related enzyme CYP720B1 (PtAO) has been shown to localize to the ER, while diterpene synthases that provide substrates are located in plastids . This compartmentalization necessitates transport of intermediates between organelles, which may be a regulatory point in the pathway. Understanding CYP720B2's localization will provide insights into:

    • Pathway compartmentalization and metabolite trafficking

    • Potential differences in substrate access compared to CYP720B1

    • Evolution of subcellular organization of terpenoid pathways

    • Potential for metabolic engineering approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.