Recombinant Pinus taeda Cytochrome P450 750A1 (CYP750A1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pinus taeda Cytochrome P450 750A1 (CYP750A1)

Cytochrome P450s (P450s) are a superfamily of enzymes found in various organisms, including plants, animals, and microorganisms, and they are involved in the metabolism of a wide array of compounds . In plants, P450s play crucial roles in the biosynthesis of various natural products, such as hormones, pigments, and defense compounds . Recombinant Pinus taeda Cytochrome P450 750A1 (CYP750A1) refers to a specific P450 enzyme originating from the loblolly pine (Pinus taeda) that has been produced using recombinant DNA technology.

Significance of CYP750A1 in Gymnosperms

The CYP750 family is an apparently gymnosperm-specific Cytochrome P450 family, with CYP750B1 being the first member of this family to be functionally characterized . Understanding the function of CYP750A1 can provide insights into the unique metabolic processes occurring in gymnosperms and their adaptation to specific environmental conditions.

Functional Characterization of CYP750 Family Members

The functional characterization of CYP750 family members, such as CYP750B1, has revealed their involvement in monoterpene hydroxylation during thujone biosynthesis in Western Redcedar . This discovery highlights the role of CYP750 enzymes in the biosynthesis of terpenes, which are essential for herbivore resistance in plants .

Recombinant Production and Assays

Recombinant CYP750A1 can be produced in heterologous expression systems, such as Saccharomyces cerevisiae, to facilitate its functional characterization . Microsomal membrane fractions from transformed yeast cells containing recombinant CYP750A1 can be used in assays to determine the enzyme's activity against various substrates .

Substrate Specificity

The substrate specificity of CYP750A1 can be determined by testing its activity against a panel of different substrates, including monoterpenes, sesquiterpenes, and nonterpenoid compounds . Identifying the preferred substrates of CYP750A1 can provide insights into its physiological role in Pinus taeda .

Data Table: Examples of data presentation

Use a TableUse a FigureUse Text
To show many and precise numerical values and other specific data in a small space To show trends, patterns, and relationships across and between datasets When you don't have extensive data to present
To compare and contrast data values with several shared characteristics or variables To summarize research results When putting your data into a table would mean creating a table with 2 or fewer columns
To show the presence or absence of specific characteristics To present a visual explanation of a sequence of events, procedures, or characteristics When the data that you are planning to present is irrelevant to the main study findings

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CYP750A1; Cytochrome P450 750A1; Cytochrome P450 CYPC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Pinus taeda (Loblolly pine)
Target Names
CYP750A1
Target Protein Sequence
MSFDKLLQALPPPLPLPAILIATFIFFFSCWILHQSQRNERLPPGPYPWPIIGNFHQVRL PLHRTLKNLAEKYGPILFLRFGSVPTVVVSSSEKAKHFLKTHDLIFASRPPTSVGKYFFY NFKDIAFSPYGDHWRKMRKICVLELLTSKRIESFKHVRQEELSAMIHSIWEESESGRIAV NVSKAISTSLANILWRILARKKFSDNDLGADGKGFADLVVEVSIAVGSLNIGDFIPYLDC LDLQGIKRALKKANARFDAFAEKMIDEHINASTIRNGEADAGCHVKDIIDVLLEMAKNDN TGAKVTREIIKAITYELFSAGMETSANVLEWAMSELLRHPHAMKKLQQEIESVVGQQGTV KESDLASIVYLHCVVKETLRLYPSLPLALPHESLEAVTVGGYYIPKKTMVIMNLWAIGRD PSVWGADASEFKPERFMQMEENGIDLSGGQSDFRMLPFGAGRRTCPGSAMAILTVEFTLA QLLHTFDWRVEGDPSELDMKEACATKMPRQTPLLAYPRLRLPRCP
Uniprot No.

Target Background

Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Cytochrome P450 750A1 (CYP750A1) in Pinus taeda and how was it identified?

Cytochrome P450 750A1 (CYP750A1) is a member of the cytochrome P450 monooxygenase superfamily identified in loblolly pine (Pinus taeda). It was discovered through phylogenetic cluster analysis of P450-like ESTs from loblolly pine. The full-length cDNA of CYP750A1 was recovered using RACE (Rapid Amplification of cDNA Ends) technology, with ATG start sites determined by alignment with known plant P450s and according to sequence context characteristic for higher plant start codons . CYP750A1 was identified alongside other P450 enzymes including CYP720B1, CYP720B2, and CYP704C1 during efforts to understand terpenoid secondary metabolism in conifers .

What is the genetic structure and characteristics of the CYP750A1 gene?

The CYP750A1 gene encodes a protein of 525 amino acids in length . Like other plant P450s, the deduced amino acid sequence shows characteristic features including:

  • An N-terminal membrane-anchoring domain

  • A heme-binding domain

  • A conserved cysteine residue essential for catalytic activity

PCR amplification of the full-length cDNA was performed using gene-specific oligonucleotide primers (primers 5 and 6 specifically for CYP750A1) . The gene is part of the extensive P450 family present in the loblolly pine genome, which has been mapped through consensus genetic mapping efforts combining data from multiple pedigrees .

How is CYP750A1 related to conifer biochemistry and defense mechanisms?

While specific functions of CYP750A1 have not been as extensively characterized as some other conifer P450s like CYP720B1 (PtAO), it likely plays a role in the terpenoid secondary metabolism of loblolly pine. Cytochrome P450 enzymes are crucial for generating structural diversity in plant terpenoid secondary metabolites, which function in defense mechanisms against herbivores and pathogens .

In conifers, P450s like CYP720B1 are involved in diterpene resin acid (DRA) biosynthesis, which is part of the oleoresin defense system. This system includes both constitutive and induced defenses that can be stimulated by threats such as insect attacks, often mediated through methyl jasmonate signaling . Given its identification alongside CYP720B1, CYP750A1 may participate in related or complementary biochemical pathways within the pine's defensive arsenal.

What are the recommended protocols for expressing recombinant CYP750A1?

Expression of recombinant CYP750A1 can be approached using methods similar to those established for other conifer P450 enzymes:

Expression System Selection:

  • E. coli: Available commercial recombinant CYP750A1 protein is produced in E. coli systems with His-tagging for purification .

  • Yeast Systems: Saccharomyces cerevisiae expression systems have proven successful for functional characterization of conifer P450s, as demonstrated with CYP720B1 .

Vector Construction Protocol:

  • PCR-amplify the full-length CYP750A1 cDNA using high-fidelity polymerase (e.g., Pfu polymerase)

  • Introduce appropriate restriction sites (such as SpeI-compatible sites)

  • Clone into an expression vector that includes:

    • Appropriate promoter (e.g., GAL1 promoter for yeast)

    • C-terminal affinity tag (e.g., His-tag or FLAG-epitope)

    • Co-expression with cytochrome P450 reductase (CPR) for functional studies

Expression Optimization:

  • Induction conditions: For yeast systems, galactose induction after initial growth in glucose media

  • Temperature adjustment: Often lowered to 20-25°C during induction to improve protein folding

  • Supplementation with δ-aminolevulinic acid (ALA) as a heme precursor

  • Addition of appropriate detergents for membrane protein solubilization

What analytical methods should be used for assessing CYP750A1 activity?

Analysis of recombinant CYP750A1 enzymatic activity requires multiple complementary approaches:

In Vitro Enzyme Assays:

  • Microsomal preparation: Isolate microsomes from expression system by differential centrifugation

  • Reaction conditions:

    • Buffer system at optimal pH (typically 7.5-7.6 for conifer P450s)

    • NADPH-regenerating system (essential cofactor)

    • Potential substrates based on structural similarity to known terpene substrates

    • Incubation at 25-30°C for 10-30 minutes

Product Analysis:

  • GC-MS analysis: For identification and quantification of terpene products

  • LC-MS/MS: For more polar or thermally labile metabolites

  • NMR spectroscopy: For structural confirmation of novel products

Enzyme Kinetics:

  • Determination of kinetic parameters (Km, Vmax) using varying substrate concentrations

  • Analysis of substrate specificity across multiple potential substrates

  • Inhibition studies using P450 inhibitors to confirm mechanism

How can researchers validate substrate specificity for CYP750A1?

Determining substrate specificity for CYP750A1 requires a systematic approach:

Substrate Candidate Selection:

  • Test diterpene alcohols and aldehydes similar to those utilized by related enzymes

  • Include various structural classes (abietane, pimarane, etc.)

  • Consider both common and clade-specific terpene skeletons

Validation Methodology:

  • In vivo yeast assays:

    • Transform yeast with CYP750A1 and CPR

    • Add candidate substrates to culture

    • Extract and analyze products by GC-MS

    • Compare with control strains lacking CYP750A1

  • In vitro microsomal assays:

    • Prepare microsomes from recombinant yeast/E. coli

    • Incubate with NADPH and candidate substrates

    • Monitor substrate disappearance and product formation

    • Calculate apparent Michaelis-Menten (Km) values for each substrate

  • Comparative analysis:

    • Compare activity across multiple substrates

    • Determine substrate preference hierarchy

    • Identify structural features that influence binding and catalysis

How does CYP750A1 compare functionally with the characterized CYP720B1 in loblolly pine?

While CYP720B1 (abietadienol/abietadienal oxidase, PtAO) has been well-characterized as a multifunctional enzyme catalyzing consecutive oxidation steps in diterpene resin acid biosynthesis, the specific function of CYP750A1 remains less defined. Comparative analysis reveals:

Functional Comparison:

CharacteristicCYP720B1 (PtAO)CYP750A1
Family classificationCYP720B subfamilyCYP750A subfamily
Sequence homology~40% amino acid identity to brassinosteroid hydroxylases (CYP90A1/B1)Distinct phylogenetic grouping
Substrate rangeMultifunctional with various diterpenoids including abietadienol, abietadienal, levopimaradienol, etc.Not fully characterized
Kinetic propertiesKm values of 0.5-5.3 μM for various substratesNot fully characterized
InducibilityMethyl jasmonate inducibleNot fully confirmed
Role in defenseConfirmed role in oleoresin defensePresumptive role in secondary metabolism

Researchers should consider co-expression analysis of both enzymes to determine potential cooperativity or complementary functions in terpenoid metabolism pathways .

What approaches can be used to elucidate the physiological role of CYP750A1 in planta?

Determining the physiological function of CYP750A1 in loblolly pine requires multiple complementary approaches:

Gene Expression Analysis:

  • Quantitative RT-PCR to measure CYP750A1 expression across tissues, developmental stages, and stress conditions

  • RNA-seq analysis to identify co-expressed genes that may function in the same pathway

  • Examination of expression following methyl jasmonate treatment to assess stress-inducibility, similar to studies with CYP720B1

Metabolomic Analysis:

  • Targeted metabolomics focusing on terpenoid profiles in tissues with high CYP750A1 expression

  • Comparative metabolomics between control and stressed plants to identify compounds correlating with CYP750A1 expression

  • Isotope labeling studies to track metabolic flux through potential CYP750A1-mediated pathways

Genetic Approaches:

  • Virus-induced gene silencing (where applicable) or RNAi approaches to reduce CYP750A1 expression

  • Heterologous overexpression in model plants followed by metabolite profiling

  • CRISPR-Cas9 editing in more amenable conifer systems or model plants expressing the enzyme

Structural Biology:

  • Homology modeling based on related P450 crystal structures

  • Substrate docking simulations to predict binding modes and substrate preferences

  • Site-directed mutagenesis of predicted catalytic residues to confirm mechanism

What bioinformatic tools and resources are most valuable for studying CYP750A1?

Researchers studying CYP750A1 should utilize several bioinformatic resources:

Sequence Analysis Tools:

  • P450 databases such as the A. thaliana P450 database (www.p450.kvl.dk) for comparative analysis

  • PlantGDB (www.plantgdb.org) for EST sequences and expression data

  • Multiple sequence alignment tools to identify conserved motifs and catalytic residues

Structural Analysis:

  • SWISS-MODEL or Phyre2 for homology modeling

  • PyMOL or Chimera for structural visualization

  • AutoDock or similar tools for substrate docking simulations

Genomic Resources:

  • Loblolly pine genetic maps including the consensus map with 357 unique molecular markers

  • Comparative genomic resources for conifers to identify syntenic regions

  • Transcript databases to identify alternative splicing variants

Expression Analysis:

  • ConGenIE.org for conifer gene expression networks

  • Microarray and RNA-seq datasets from stress response studies

  • Co-expression databases to identify functional gene modules

How might environmental stresses affect CYP750A1 expression in loblolly pine?

Environmental stress response is a critical aspect of cytochrome P450 function in conifers:

Stress Response Patterns:
Studies with related conifer P450s suggest that CYP750A1 may respond to:

  • Biotic Stresses:

    • Insect herbivory: May induce expression as part of induced defensive response

    • Fungal pathogens: Could trigger expression through jasmonate signaling pathways

    • Mechanical wounding: May simulate herbivore damage and induce expression

  • Abiotic Stresses:

    • Drought: Studies on loblolly pine under experimental drought conditions show complex metabolic responses that likely involve P450 enzymes

    • Temperature extremes: May alter terpenoid metabolism as part of acclimation response

    • Soil conditions: Nutrient availability can influence secondary metabolism pathways

Research Approaches:

  • Field studies comparing CYP750A1 expression across environmental gradients

  • Controlled environment experiments with defined stress treatments

  • Combined transcriptomic and metabolomic analyses to correlate gene expression with metabolite changes

  • Stable isotope analysis (δ13C and δ18O) to correlate water use efficiency with defensive metabolism

What are the best experimental controls when working with recombinant CYP750A1?

Proper controls are essential for reliable research on recombinant CYP750A1:

Negative Controls:

  • Expression host containing empty vector

  • Expression host with an unrelated P450 or catalytically inactive CYP750A1 mutant

  • Heat-denatured enzyme preparations

  • Assays without NADPH or without substrate

  • Yeast strains expressing cytochrome P450 reductase (CPR) without P450 cDNA

Positive Controls:

  • Well-characterized pine P450 enzyme like CYP720B1 tested in parallel

  • Commercial P450 with known activity to validate assay conditions

  • Internal standard compounds for analytical methods

Validation Controls:

  • Multiple biological replicates from independent transformations

  • Expression level confirmation by immunoblot analysis

  • Functional validation using multiple analytical approaches

  • CO-difference spectrum analysis to confirm properly folded heme domain

How can researchers troubleshoot low activity or expression of recombinant CYP750A1?

Cytochrome P450 enzymes from conifers can present expression challenges:

Common Issues and Solutions:

ProblemPotential Solutions
Low expression level- Optimize codon usage for expression host
- Test different promoters and vector systems
- Reduce culture temperature during induction
- Try different host strains
Poor solubility- Modify N-terminal membrane anchor
- Use detergents for solubilization
- Create fusion proteins with solubility tags
- Express in microsomal systems rather than as isolated protein
Low enzymatic activity- Ensure sufficient NADPH supply
- Co-express with appropriate cytochrome P450 reductase
- Optimize buffer conditions (pH, ionic strength)
- Test broader range of potential substrates
- Add heme precursors to expression medium
Substrate availability- Synthesize or isolate potential substrates
- Use surrogate substrates for initial screening
- Collaborate with natural product chemists for rare compounds
Analytical sensitivity- Develop more sensitive detection methods
- Concentrate products before analysis
- Use derivatization to improve detection
- Consider radioisotope labeling studies

When troubleshooting expression issues, systematic testing of changes to expression conditions and careful documentation of results is essential for success .

What are the future research directions for CYP750A1 and related conifer P450 enzymes?

Future research on CYP750A1 and related conifer P450 enzymes should explore:

Emerging Research Areas:

  • Synthetic Biology Applications:

    • Engineering enhanced terpene production in microbial hosts

    • Designing enzyme variants with novel substrate specificities

    • Creating artificial metabolic pathways incorporating CYP750A1

  • Ecological and Evolutionary Studies:

    • Comparative analysis across pine species to understand evolutionary divergence

    • Ecological studies correlating enzyme variants with resistance to specific threats

    • Climate change adaptation mechanisms involving terpenoid metabolism

  • Multi-Omics Integration:

    • Combined genomic, transcriptomic, proteomic, and metabolomic analysis

    • Network modeling of terpenoid biosynthetic pathways

    • Systems biology approaches to understand regulation of defensive metabolism

  • Advanced Structural Biology:

    • Cryo-EM structures of membrane-bound P450 complexes

    • Time-resolved crystallography to capture reaction intermediates

    • Computational simulations of enzyme dynamics during catalysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.