Recombinant Pinus thunbergii Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize developing the specified tag.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-319
Protein Length
Full Length of Mature Protein
Species
Pinus thunbergii (Japanese black pine) (Pinus thunbergiana)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLAKKPVDIEVPQSVLPNTVFEAVVKIPYDMQMKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEIRQKTGNLYFQNYRPNKKNIIVIGPVPG QKYSELVFPILSPDPSTDKEAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYSASATGRVS KILRKEKGGYEITIDNTSDGGQVVDIVPPGPELLISEGELIKVDQPLTNNPNLGGFGQGD AEIVLQDPLRVKGLLLFLASVILAQIFLVLKKKQFEKVQLAEMNL
Uniprot No.

Target Background

Function
Recombinant *Pinus thunbergii* Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the genomic organization of the petA gene in Pinus thunbergii?

Unlike many photosynthetic organisms where the petA gene is located in the chloroplast genome, genetic studies suggest possible nuclear localization in some conifers. In Pinus thunbergii, genomic analysis is complicated by its large genome size of approximately 25 Gbps across 12 chromosomes (2n = 24) . While complete genomic characterization remains challenging due to the absence of a reference genome sequence, high-density genetic mapping approaches have proven valuable for identifying gene locations within the P. thunbergii genome. Current methodologies typically employ genotyping-by-sequencing (GBS) to generate single-nucleotide polymorphism (SNP) markers that can be used for constructing linkage maps with sufficient resolution to locate genes of interest .

What methodological approaches are most effective for isolating the petA gene from P. thunbergii?

The most effective methodology for petA gene isolation from P. thunbergii involves:

  • Initial PCR-based approach: Design degenerate primers based on conserved regions of cytochrome f sequences from related conifers

  • cDNA library screening: Construct a cDNA library from photosynthetically active tissues and screen using labeled probes

  • Genome walking: Use known sequence fragments to extend toward 5' and 3' ends

  • RT-PCR verification: Confirm expression and full sequence using tissue-specific RNA

  • Next-generation sequencing: Employ RNA-seq to identify the complete transcript

A combined approach typically yields the most reliable results, particularly when dealing with a complex genome lacking a reference sequence .

What expression systems are most suitable for producing recombinant P. thunbergii apocytochrome f?

The optimal expression system depends on research objectives but must address several challenges specific to plant membrane proteins. A methodological comparison includes:

Expression SystemAdvantagesLimitationsYieldPost-translational Modifications
E. coliRapid growth, simple genetics, cost-effectiveLimited post-translational modifications, inclusion body formationModerate (5-10 mg/L)Minimal
Yeast (P. pastoris)Eukaryotic processing, scalableLonger expression timeGood (10-20 mg/L)Intermediate
Insect cellsSuperior membrane protein foldingComplex methodology, expensiveGood (15-25 mg/L)Advanced
Plant-based systemsNative-like processingTime-consuming, lower yieldsLow-moderate (1-5 mg/L)Most complete

For functional studies requiring proper heme incorporation, either the P. pastoris system with supplemented delta-aminolevulinic acid or a plant-based expression system would be recommended, despite potentially lower yields .

What are the critical factors for successful purification of recombinant P. thunbergii apocytochrome f?

Successful purification requires addressing several methodological challenges:

  • Membrane protein solubilization: Select appropriate detergents (typically n-dodecyl β-D-maltoside or digitonin) that maintain protein stability while effectively solubilizing the membrane-embedded regions.

  • Affinity tag selection: For recombinant proteins, a C-terminal His-tag placement is preferred over N-terminal tagging to avoid interference with the transit peptide and protein folding.

  • Critical purification steps:

    • Initial membrane isolation by differential centrifugation

    • Controlled solubilization with optimized detergent concentration

    • Metal affinity chromatography with imidazole gradient elution

    • Size exclusion chromatography for final purification

  • Buffer optimization: Maintain pH between 7.0-7.5 with appropriate ionic strength (typically 100-150 mM NaCl) and include glycerol (10-15%) to enhance stability.

  • Preserving heme integrity: Add reducing agents (1-5 mM β-mercaptoethanol) to prevent oxidative damage to the heme group during purification .

How can researchers effectively assess the proper folding and heme incorporation in recombinant P. thunbergii apocytochrome f?

Proper folding and heme incorporation represent critical quality control measures for functional recombinant cytochrome f. A comprehensive assessment protocol includes:

  • Spectroscopic analysis: UV-visible spectroscopy should reveal characteristic peaks at approximately 420 nm (Soret band) and 520-550 nm (α and β bands) in the reduced state. The ratio between these peaks provides quantitative measurement of heme incorporation efficiency.

  • Circular dichroism (CD) spectroscopy: Compare the CD spectrum with native cytochrome f to assess secondary structure integrity.

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): Evaluate monodispersity and oligomeric state.

  • Redox potential measurement: Using potentiometry with appropriate reference electrodes to determine if the recombinant protein exhibits the expected midpoint potential.

  • Functional assays: Measuring electron transfer capability using artificial electron donors and acceptors or reconstituted systems with plastocyanin .

What advanced techniques are available for analyzing the structural dynamics of P. thunbergii apocytochrome f?

For advanced structural characterization, researchers should consider:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique provides insights into protein dynamics and solvent accessibility by measuring the rate of hydrogen exchange with deuterium at various protein regions. For apocytochrome f, this can identify flexible regions and potential interaction interfaces.

  • Single-molecule FRET (smFRET): By introducing fluorescent labels at strategic positions, researchers can monitor distance changes between protein domains during electron transfer or in response to different environments.

  • Cryo-electron microscopy: For structural analysis either of the isolated protein or in the context of the complete cytochrome b6f complex.

  • Molecular dynamics simulations: Computational approaches that can predict conformational changes based on the protein structure, particularly useful for examining the behavior of the unique domains in different species.

  • Time-resolved spectroscopy: To capture the kinetics of electron transfer processes with picosecond to millisecond resolution .

What methods can be used to investigate the expression regulation of the petA gene in P. thunbergii under varying environmental conditions?

Investigating environmental regulation of petA expression requires a multi-layered methodological approach:

  • Quantitative RT-PCR: The gold standard for gene expression quantification, requiring appropriate reference genes for P. thunbergii (often actin or elongation factors).

  • RNA-Seq analysis: For genome-wide expression profiling under different conditions, allowing identification of co-regulated genes.

  • Promoter analysis: Cloning the petA promoter region and fusing it with reporter genes (GFP, LUC) to monitor expression in vivo.

  • Chromatin immunoprecipitation (ChIP): To identify transcription factors binding to the petA promoter under different conditions.

  • CRISPR-Cas9 mediated manipulation: For functional validation of regulatory elements, though this remains technically challenging in conifers.

  • Experimental design considerations:

    • Include appropriate time-course sampling after environmental changes

    • Systematically test individual variables (light intensity, temperature, water availability)

    • Analyze tissue-specific responses (young vs. mature needles)

    • Compare responses across different conifer species

How can recombinant P. thunbergii apocytochrome f be utilized in studies of stress response in conifers?

Recombinant P. thunbergii apocytochrome f offers several methodological applications for stress response studies:

  • Antibody production: Using purified recombinant protein to generate specific antibodies for monitoring native protein levels during stress conditions.

  • In vitro stress models: Exposing the purified protein to oxidative conditions, varying pH, or temperature stress to assess structural and functional changes.

  • Protein-protein interaction studies: Identifying stress-induced changes in interaction partners using techniques like pull-down assays, bio-layer interferometry, or surface plasmon resonance.

  • Comparative analysis: Using the recombinant protein as a standard to quantify post-translational modifications occurring under stress conditions in vivo.

  • Functional reconstitution: Incorporating the recombinant protein into liposomes or nanodiscs to study electron transport efficiency under varying conditions that mimic environmental stress .

What are the most promising approaches for using petA gene modifications to enhance photosynthetic efficiency in conifers?

Engineering the petA gene for enhanced photosynthetic efficiency presents several methodological approaches:

  • Site-directed mutagenesis: Introducing specific amino acid substitutions based on comparative analysis with species showing higher electron transport rates.

  • Domain swapping: Replacing specific domains with counterparts from species with more efficient photosynthetic parameters.

  • Promoter modification: Altering expression levels or patterns to optimize cytochrome f abundance under varying light conditions.

  • Transformation considerations:

    • Agrobacterium-mediated transformation remains challenging but potentially most stable

    • Biolistic methods offer higher transformation rates but more variability

    • Protoplast-based approaches for initial functional testing

  • Phenotypic evaluation protocol:

    • Chlorophyll fluorescence measurements (ΦPSII, NPQ, Fv/Fm)

    • Gas exchange parameters (CO2 assimilation rates)

    • Growth rate and biomass accumulation under controlled conditions

    • Stress resilience testing (recovery after drought, temperature extremes)

These approaches require significant optimization for the recalcitrant conifer transformation systems but offer potential for developing more climate-resilient and productive forest species .

What are the most common challenges in expressing functional recombinant P. thunbergii apocytochrome f and how can they be addressed?

Researchers frequently encounter several methodological challenges:

  • Incorrect heme incorporation: Often manifesting as brownish protein rather than the characteristic reddish color.

    • Solution: Supplement expression media with δ-aminolevulinic acid (ALA) at 0.5-1.0 mM and optimize growth temperature (typically lower to 16-20°C).

  • Inclusion body formation in bacterial systems:

    • Solution: Express as fusion with solubility-enhancing tags (MBP, SUMO) or utilize lower induction levels (0.1-0.2 mM IPTG) with extended expression times at reduced temperatures.

  • Proteolytic degradation:

    • Solution: Include protease inhibitor cocktails throughout purification and consider C-terminal rather than N-terminal tagging to protect against N-terminal processing.

  • Low expression levels:

    • Solution: Optimize codon usage for the expression host and consider screening multiple construct designs with varying N-terminal modifications.

  • Protein aggregation during purification:

    • Solution: Test multiple detergents (DDM, LMNG, GDN) at different concentrations and incorporate stabilizing agents like glycerol (10%) or specific lipids (POPG at 0.01-0.05 mg/ml) .

What quality control metrics should be established for recombinant P. thunbergii apocytochrome f preparation?

Rigorous quality control is essential for reliable experimental outcomes. A comprehensive QC protocol should include:

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (>90% purity)

    • Western blot confirmation using anti-His and anti-cytochrome f antibodies

    • Heme-specific staining to confirm incorporation

  • Functional metrics:

    • UV-visible spectroscopy ratios (A420/A280 > 2.5 for high heme incorporation)

    • Redox potential within 10% of literature values for native protein

    • Electron transfer rate with physiological partners

  • Structural integrity:

    • Circular dichroism spectra matching predicted secondary structure content

    • Thermal stability assessment (Tm within 5°C of native protein)

    • Size exclusion chromatography profile (monodisperse peak)

  • Batch consistency markers:

    • Specific activity measurements standardized across preparations

    • Freeze-thaw stability (retention of >85% activity after 3 cycles)

    • Long-term storage stability at -80°C (>3 months with <10% activity loss)

How can high-density genetic mapping approaches benefit studies of P. thunbergii apocytochrome f?

High-density genetic mapping offers several methodological advantages for petA research:

  • Precise genomic localization: Incorporating the petA gene into existing linkage maps can reveal its chromosomal context and identify potential regulatory regions through proximity to other genes.

  • QTL association studies: Using genotyping-by-sequencing (GBS) approaches with phenotypic data can identify natural variations in the petA gene or its regulatory elements that correlate with photosynthetic efficiency traits.

  • Methodological approach:

    • Develop a mapping population (F2, backcross, or self-pollinated)

    • Genotype using GBS to generate thousands of SNP markers

    • Construct a high-density linkage map with 12-13 linkage groups corresponding to the P. thunbergii chromosomes

    • Map the petA gene location using sequence-specific markers

    • Identify potential regulatory QTLs through association with expression levels

  • Integration with existing resources:

    • Anchor the new markers with previously described EST-derived SNPs and SSR markers

    • Cross-reference with transcriptome data to identify co-expressed genes

What bioinformatic pipelines are most effective for analyzing the structural features of P. thunbergii apocytochrome f?

Effective structural analysis requires integrated bioinformatic approaches:

  • Sequence analysis pipeline:

    • Multiple sequence alignment with diverse cytochrome f sequences using MUSCLE or MAFFT

    • Phylogenetic tree construction to establish evolutionary relationships

    • Conservation analysis using ConSurf to identify functionally important residues

    • Codon usage analysis to detect evidence of gene transfer events

  • Structural prediction workflow:

    • Homology modeling using existing cytochrome f structures as templates

    • Model refinement focusing on species-specific insertions/deletions

    • Molecular dynamics simulations to assess stability of predicted structures

    • Docking studies with interaction partners (plastocyanin, cytochrome b6)

  • Functional annotation:

    • Identification of domains using InterPro and Pfam

    • Prediction of post-translational modifications

    • Transmembrane region analysis

    • Protein-protein interaction prediction

  • Integration with experimental data:

    • Map spectroscopic data onto structural models

    • Correlate mutagenesis results with structural features

    • Guide design of future experiments based on structural insights

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.