Recombinant Pinus thunbergii Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare your order according to your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
full length protein
Species
Pinus thunbergii (Japanese black pine) (Pinus thunbergiana)
Target Names
cemA
Target Protein Sequence
MDPIPHSITRTLSRFRTELTSESGSLAIHELEVSEYKASASLRYLACLVVLPWVIPISLR KGLEPWVTNWWNTVKSQKIFDYLQEQNALGRFEKIEELFLLERMVEDSLGTHSQSIRIEI HKETIQLVEMYNEDCIQIISHLLTNLIGFAFISAYIILGKNKLAIINSWIQEFFYSLSDT MKAFLILLATDLCIGFHSPHGWELMIDSISESYGFAHNERIISGLVSTFPVILDTILKYW IFRRFNRISPSLVVIYHSMNE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion. It indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the cemA gene and how is it organized in plant chloroplast genomes?

The cemA gene encodes a chloroplast envelope membrane protein that is present in the chloroplast genomes of most land plants. In model organisms like Chlamydomonas reinhardtii, cemA is part of the atpA gene cluster, which includes the atpA, psbI, cemA, and atpH genes . The cemA gene encodes a protein involved in the chloroplast envelope membrane function.

Unlike adjacent genes such as atpA, psbI, and atpH which have their own promoters, the cemA gene in Chlamydomonas lacks its own promoter, suggesting it may be co-transcribed with other genes . In conifer species like Pinus thunbergii, the organization may differ from that of algae or angiosperms, reflecting the evolutionary divergence of gymnosperms.

Methodologically, researchers investigating cemA gene architecture should employ genome walking techniques, RNA-seq analysis, and 5' RACE (Rapid Amplification of cDNA Ends) to accurately characterize transcription start sites and determine whether cemA is independently transcribed or part of a polycistronic unit in Pinus thunbergii.

How conserved is the cemA gene across different plant lineages?

The conservation of cemA varies significantly across plant lineages, with evidence suggesting differential retention and loss patterns. While cemA is generally present in land plant plastomes, significant variations exist, particularly in certain clades.

In the Selaginellaceae family, studies have documented that several genes, including cemA, rpl32, rps15, and rps16, were absent in the plastomes of almost all Selaginella species except for S. kraussiana and S. lepidophylla . This pattern of gene loss contrasts with other lycophyte families where these genes are retained.

To assess cemA conservation in Pinus thunbergii relative to other gymnosperms, researchers should:

  • Perform comparative genomic analyses across multiple conifer species

  • Construct phylogenetic trees based on cemA sequences

  • Calculate selection pressures (dN/dS ratios) to evaluate evolutionary constraints

  • Use synteny mapping to identify potential rearrangements affecting the cemA locus

These approaches will help determine whether cemA in Pinus thunbergii exhibits typical conservation patterns or lineage-specific adaptations.

What are the predicted functional domains of cemA protein in Pinus thunbergii?

While specific structural data for Pinus thunbergii cemA is limited, researchers can employ several bioinformatic approaches to predict functional domains:

  • Transmembrane domain prediction using TMHMM, Phobius, or TOPCONS

  • Protein family database (Pfam) searches to identify conserved domains

  • Hydrophobicity analysis to identify membrane-spanning regions

  • Secondary structure prediction using JPred or PSIPRED

The cemA protein is expected to contain multiple transmembrane domains consistent with its localization in the chloroplast envelope membrane. Based on studies in other species, cemA likely functions in CO₂ uptake processes, potentially through interaction with other membrane components of the carbon concentration mechanism.

To experimentally verify these predictions in Pinus thunbergii specifically, researchers should consider epitope tagging combined with protease protection assays to determine membrane topology, and co-immunoprecipitation experiments to identify interacting partners.

What expression systems are most suitable for recombinant Pinus thunbergii cemA protein?

The choice of expression system for recombinant cemA from Pinus thunbergii requires careful consideration due to its hydrophobic nature as a membrane protein. Several expression systems can be employed with specific modifications:

Expression SystemAdvantagesDisadvantagesRecommended Modifications
E. coliHigh yield, simple, inexpensiveMembrane protein folding challenges, inclusion body formationUse C41(DE3) or C43(DE3) strains; fusion with solubility tags (MBP, SUMO); lower induction temperature (16-20°C)
Yeast (P. pastoris)Eukaryotic folding machinery, glycosylation capabilityLonger expression time, potential hyperglycosylationMethanol-inducible promoters; optimized codon usage
Insect cellsSuperior folding of complex proteinsHigher cost, technical complexityBaculovirus expression vector system with 6xHis tag
Plant-based systemsNative-like environmentLower yield, time-consumingTransient expression in N. benthamiana with chloroplast targeting

For initial studies, a dual approach is recommended: (1) E. coli expression for structural studies and antibody production, using fusion tags to enhance solubility, and (2) plant-based expression systems for functional studies. Both systems should incorporate affinity tags (6xHis, Strep-tag II) for purification, with careful optimization of detergent selection for membrane protein extraction.

How can I optimize purification protocols for recombinant cemA protein?

Purifying recombinant cemA protein presents significant challenges due to its hydrophobic nature and membrane localization. An optimized purification workflow involves:

  • Membrane fraction isolation

    • Differential centrifugation (10,000g for cell debris removal, 100,000g for membrane fraction)

    • Sucrose gradient ultracentrifugation to separate different membrane fractions

  • Detergent solubilization optimization

    • Screen multiple detergents: DDM (n-Dodecyl β-D-maltoside), LMNG, Digitonin

    • Test detergent concentrations (typically 1-2% for extraction, 0.1-0.2% for purification)

    • Include glycerol (10-20%) to enhance stability

  • Multi-step chromatography

    • Initial IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA

    • Ion exchange chromatography to remove contaminants

    • Size exclusion chromatography for final polishing and detergent exchange

  • Quality assessment

    • SDS-PAGE with western blotting

    • Mass spectrometry for identity confirmation

    • Circular dichroism to verify secondary structure

Researchers should perform small-scale pilot experiments testing different detergent-to-protein ratios before scaling up. For structural studies, consider reconstitution into nanodiscs or amphipols to maintain native-like membrane environment.

What techniques are available for verifying the functional integrity of purified cemA protein?

Verifying the functional integrity of recombinant cemA protein requires a multi-faceted approach:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content

    • Fluorescence spectroscopy to assess tertiary folding

    • Limited proteolysis to evaluate domain organization

  • Membrane incorporation assays:

    • Liposome reconstitution efficiency

    • Sucrose flotation assays to confirm membrane association

    • Freeze-fracture electron microscopy to visualize membrane insertion

  • Functional assays:

    • CO₂ uptake measurements in proteoliposomes

    • Patch-clamp electrophysiology if ion channel properties are suspected

    • pH-dependent activity measurements

  • Interaction studies:

    • Pull-down assays with potential partner proteins

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

For Pinus thunbergii cemA specifically, researchers should develop comparative functional assays against other conifer cemA proteins to identify species-specific characteristics. Including positive controls (known functional membrane proteins) and negative controls (denatured cemA) is essential for result interpretation.

How should researchers approach phylogenetic analysis of cemA across gymnosperm species?

Conducting robust phylogenetic analysis of cemA across gymnosperms requires careful methodological considerations:

  • Sequence acquisition and alignment:

    • Extract cemA sequences from complete chloroplast genomes

    • Use translation alignment (MACSE or TranslatorX) to maintain codon integrity

    • Apply profile-based alignment tools (MAFFT G-INS-i) for higher accuracy

  • Model selection and tree construction:

    • Perform model testing (ModelTest-NG, PartitionFinder) for appropriate evolutionary models

    • Use both Maximum Likelihood (RAxML, IQ-TREE) and Bayesian (MrBayes, BEAST) approaches

    • Apply codon-based models to detect selection signatures

  • Topology testing and assessment:

    • Bootstrap analysis (>1000 replicates) for branch support

    • Shimodaira-Hasegawa (SH) and approximately unbiased (AU) tests to compare alternative topologies

    • Posterior probability assessments for Bayesian analyses

The cemA phylogeny should be compared with species phylogeny to identify potential horizontal gene transfer events or unusual evolutionary rates. Researchers should be particularly attentive to gene loss patterns, as studies in Selaginellaceae have documented variable gene loss across lineages, including cemA .

Analysis ApproachRecommended SoftwareKey ParametersOutput Analysis
Maximum LikelihoodIQ-TREE-m MFP (model finder), -b 1000 (bootstrap)UFBoot values >95%
Bayesian InferenceMrBayesNgen=10M, samplefreq=1000, burnin=25%PP values >0.95
Selection AnalysisPAML (codeml)Site models M0, M1a, M2a, M7, M8LRT for positive selection

What patterns of gene loss and pseudogenization have been observed in cemA across plant lineages?

Gene loss and pseudogenization of chloroplast genes, including cemA, represent significant evolutionary events across plant lineages. Research has documented several patterns:

  • Complete gene loss:

    • In Selaginellaceae, cemA is absent in the plastomes of almost all Selaginella species except S. kraussiana and S. lepidophylla

    • This loss pattern often occurs in conjunction with other genes (rpl32, rps15, rps16)

  • Pseudogenization:

    • Functional degradation through frameshift mutations

    • Accumulation of premature stop codons

    • Loss of regulatory elements while coding sequence remains

  • Lineage-specific patterns:

    • Variable retention across sister species

    • Correlation with ecological transitions or genome rearrangements

To investigate cemA pseudogenization in Pinus thunbergii and related species, researchers should:

  • Examine reading frame integrity across full-length sequences

  • Calculate dN/dS ratios to detect relaxed selection

  • Assess transcription using RT-PCR and RNA-Seq data

  • Compare sequence conservation at functionally critical residues

Understanding these patterns provides insights into the functional constraints on cemA and the potential compensatory mechanisms that evolve when the gene is lost or pseudogenized.

How do structural rearrangements in chloroplast genomes affect cemA gene evolution?

Chloroplast genomes undergo various structural rearrangements that can significantly impact the evolution of genes like cemA. Based on research findings, several mechanisms and patterns are relevant:

  • Inversion events:

    • Large inversions like the 30-kb inversion (ycf2-psbM) detected in seed plants relative to bryophytes and lycophytes can alter gene context and expression

    • Inversions may include regulatory elements, affecting gene expression

  • Expansion/contraction of inverted repeats:

    • The transition between IR and DR (direct repeat) structures observed in Selaginellaceae can incorporate genes previously in single-copy regions

    • These events may duplicate genes or alter their regulatory context

  • Gene cluster reorganization:

    • The atpA gene cluster in Chlamydomonas includes cemA without its own promoter

    • Rearrangements can separate genes from their promoters or create new transcriptional units

  • Local collinear blocks (LCBs):

    • Studies have identified multiple LCBs in chloroplast genomes, with significant variation in their order and orientation across lineages

    • These rearrangements can affect the genomic context of cemA

For investigating how these rearrangements affect cemA in Pinus thunbergii, researchers should:

  • Perform whole-genome alignments across multiple conifer species

  • Identify syntenic blocks containing cemA and adjacent genes

  • Characterize the boundaries of any rearrangements near the cemA locus

  • Correlate structural changes with alterations in expression patterns or selective pressures

These analyses will provide insights into how genomic architecture influences cemA evolution in gymnosperms.

How should researchers design experiments to characterize cemA function in chloroplast membranes?

Designing robust experiments to characterize cemA function requires comprehensive planning:

  • Experimental system selection:

    • In vitro: Reconstituted proteoliposomes with purified recombinant cemA

    • Ex vivo: Isolated chloroplasts from Pinus thunbergii

    • In vivo: Transgenic models with modified cemA expression

  • Control design:

    • Positive controls: Known functional chloroplast membrane proteins

    • Negative controls:

      • Empty vector/mock transformations

      • Denatured protein preparations

      • Site-directed mutants of conserved residues

  • Functional assays:

    • CO₂ uptake measurements using radioactive (¹⁴C) or stable isotope (¹³C) labeling

    • Membrane potential measurements with voltage-sensitive dyes

    • pH-dependent activity using fluorescent pH indicators

  • Validation approaches:

    • Complementation studies in model systems

    • CRISPR-mediated knockout/knockdown with phenotypic analysis

    • Correlation of activity with protein expression levels

A critical consideration is maintaining the native lipid environment or reconstituting with chloroplast-like lipid compositions (MGDG, DGDG, SQDG, and PG) for functional assays. Researchers should also account for species-specific differences when extrapolating from model organisms to Pinus thunbergii.

What controls are essential when studying protein-protein interactions involving cemA?

Investigating protein-protein interactions involving cemA requires rigorous controls to ensure specificity and biological relevance:

  • Method-specific controls:

    • Co-immunoprecipitation:

      • IgG control for non-specific binding

      • Reciprocal pull-downs (tag cemA interaction partners)

      • Competitive binding with excess untagged protein

    • Yeast two-hybrid:

      • Empty vector controls

      • Unrelated protein pairs (negative control)

      • Known interacting pairs (positive control)

    • FRET/BiFC:

      • Single fluorophore constructs

      • Non-interacting protein pairs

  • Subcellular localization validation:

    • Confirm chloroplast envelope localization using:

      • Confocal microscopy with fluorescent tags

      • Subcellular fractionation with western blotting

      • Protease protection assays to determine topology

  • Functional validation:

    • Evaluate the effect of mutations at interaction interfaces

    • Assess co-expression patterns across tissues and conditions

    • Test functional consequences of disrupting interactions

  • Specificity controls:

    • Test interactions under varying salt concentrations

    • Include detergent controls to rule out hydrophobic aggregation

    • Perform size exclusion chromatography to verify complex formation

These controls help distinguish genuine biological interactions from technical artifacts, particularly important for membrane proteins like cemA which can aggregate non-specifically.

How can researchers effectively isolate intact chloroplasts from Pinus thunbergii for cemA studies?

Isolating intact, functional chloroplasts from conifer species like Pinus thunbergii presents unique challenges due to their resinous nature and tough tissues. An optimized protocol would include:

  • Tissue preparation:

    • Use young needles (current year's growth) harvested in early morning

    • Pre-chill all equipment and buffers to 4°C

    • Rinse thoroughly with cold distilled water to remove resin

  • Grinding medium optimization:

    • Base buffer: 50 mM HEPES-KOH (pH 7.5), 330 mM sorbitol

    • Protective additions: 1 mM MgCl₂, 1 mM MnCl₂, 2 mM EDTA

    • Reducing agents: 5 mM ascorbate, 5 mM cysteine, 0.1% BSA

    • Specific for conifers: 1% PVP-40 to absorb phenolics and resins

  • Isolation procedure:

    • Gentle homogenization using a polytron (2-3 bursts of 5 seconds)

    • Filtration through multiple layers of Miracloth

    • Differential centrifugation (300g for 1 min to remove debris)

    • Intact chloroplast pelleting (1000g for 5 min)

    • Percoll gradient purification (40%/80% step gradient)

  • Quality assessment:

    • Phase contrast microscopy for intactness

    • Hill reaction for functional integrity

    • Immunoblotting for envelope markers

For cemA-specific studies, researchers should optimize the isolation of envelope membranes from purified chloroplasts using osmotic shock followed by sucrose gradient ultracentrifugation to separate inner and outer envelope fractions. This allows specific localization and functional studies of cemA in its native membrane environment.

How can researchers resolve inconsistent results in cemA functional assays?

Inconsistent results in cemA functional assays typically stem from several sources that require systematic troubleshooting:

  • Protein quality issues:

    • Verify protein folding using circular dichroism

    • Assess membrane incorporation efficiency

    • Check for degradation with western blotting before each assay

    • Ensure proper reconstitution in appropriate lipid environments

  • Experimental variables standardization:

    • Maintain consistent temperature (±0.5°C) throughout experiments

    • Control pH precisely (±0.1 units) for all buffers

    • Standardize protein:lipid ratios in reconstitution experiments

    • Use internal standards for quantitative measurements

  • Technical optimization:

    • For CO₂ uptake assays:

      • Control dissolved CO₂ concentrations precisely

      • Account for non-specific binding/diffusion

      • Use time-course measurements rather than single time points

    • For interaction studies:

      • Optimize detergent types and concentrations

      • Control salt and pH to physiological ranges

  • Statistical approaches:

    • Use paired experimental designs where possible

    • Increase biological replicates (minimum n=5)

    • Apply appropriate statistical tests with correction for multiple comparisons

    • Consider Bayesian analysis for complex datasets with high variability

When troubleshooting, implement changes systematically (one variable at a time) and maintain detailed records of all experimental conditions. For particularly variable assays, consider developing internal normalization standards or reference reactions that can be used to calibrate results across experimental runs.

What statistical approaches are appropriate for analyzing cemA sequence diversity across conifer species?

Analyzing cemA sequence diversity across conifers requires specialized statistical approaches to account for evolutionary relationships and selection pressures:

  • Diversity metrics:

    • Nucleotide diversity (π) - average number of nucleotide differences per site

    • Haplotype diversity (Hd) - probability that two randomly chosen sequences are different

    • Tajima's D - detection of selection versus neutral evolution

    • Fu and Li's tests - identification of recent selection events

  • Comparative analyses:

    • McDonald-Kreitman test to compare intraspecific polymorphism with interspecific divergence

    • Hudson-Kreitman-Aguadé (HKA) test to compare diversity patterns across multiple loci

    • dN/dS ratio analysis using maximum likelihood methods (PAML, HyPhy)

  • Population structure considerations:

    • AMOVA (Analysis of Molecular Variance) to partition genetic variation

    • FST calculations to quantify differentiation between populations

    • Bayesian clustering methods to identify population structure

  • Phylogenetic signal testing:

    • Blomberg's K and Pagel's λ to measure phylogenetic signal

    • Phylogenetic independent contrasts to account for relatedness

    • Phylogenetic generalized least squares (PGLS) for comparative analyses

Analysis TypeAppropriate SoftwareKey ParametersInterpretation Guidelines
DiversityDnaSP, MEGAWindow size: 100bp, step: 25bpπ > 0.01 indicates high diversity
SelectionPAML (codeml)Models: M0, M1a, M2a, M7, M8LRT p < 0.05 indicates selection
PopulationArlequin, StructureMCMC reps: 100,000FST > 0.15 indicates significant differentiation

When analyzing cemA specifically, researchers should compare its diversity patterns with other chloroplast genes to identify unusual evolutionary patterns that might indicate functional shifts or adaptation.

What are common pitfalls in expressing recombinant conifer chloroplast proteins and how can they be addressed?

Expression of recombinant conifer chloroplast proteins presents several challenges that require specific troubleshooting approaches:

  • Codon usage optimization:

    • Pitfall: Conifer-specific codon bias incompatible with expression hosts

    • Solution:

      • Generate codon-optimized synthetic genes

      • Calculate Codon Adaptation Index (CAI) before expression

      • Target CAI values >0.8 for optimal expression

  • Toxicity to expression hosts:

    • Pitfall: Membrane proteins like cemA can disrupt host cell membranes

    • Solution:

      • Use tightly regulated inducible promoters (T7-lac, araBAD)

      • Employ specialized strains (C41/C43, Lemo21)

      • Lower induction temperature (16-20°C)

      • Use milder inducers at reduced concentrations

  • Protein aggregation:

    • Pitfall: Formation of inclusion bodies or improper folding

    • Solution:

      • Fusion with solubility-enhancing tags (MBP, SUMO, TrxA)

      • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)

      • Addition of specific lipids during extraction

      • Use of mild detergents (DDM, LMNG) for extraction

  • Low yield:

    • Pitfall: Poor expression levels common for membrane proteins

    • Solution:

      • Scale up culture volumes

      • Optimize growth conditions (media composition, aeration)

      • Use high cell-density systems (fed-batch fermentation)

      • Test multiple purification approaches in parallel

For cemA specifically, researchers have reported success using a dual-strategy approach: expressing the hydrophilic domains separately for structural studies, while using full-length constructs in specialized membrane protein expression systems for functional studies.

How can genome editing technologies be applied to study cemA function in conifer chloroplasts?

Applying genome editing to conifer chloroplasts presents unique challenges but offers powerful approaches for cemA functional studies:

  • Chloroplast transformation strategies:

    • Biolistic transformation using species-optimized gold particle bombardment

    • PEG-mediated transformation of isolated protoplasts

    • TALE/CRISPR-directed nucleases with chloroplast targeting sequences

  • CRISPR-based approaches:

    • Base editors (BE4, Target-AID) for precise mutation introduction

    • Prime editing for targeted sequence replacements

    • CRISPR interference (CRISPRi) using deactivated Cas9 for transient repression

  • Target design considerations:

    • Design sgRNAs targeting conserved functional domains

    • Create allelic series with varying mutation severity

    • Generate silent markers to track editing events

    • Design homology templates with selectable markers

  • Phenotypic analysis:

    • High-throughput chlorophyll fluorescence imaging

    • Gas exchange measurements under varying CO₂ concentrations

    • Metabolomic profiling to detect pathway alterations

    • Comparative growth analysis under different environmental conditions

For gymnosperms specifically, researchers must account for several factors:

  • Lower transformation efficiency requires extensive screening

  • Longer generation times necessitate optimized tissue culture systems

  • Haploid megagametophyte tissue can be advantageous for mutation detection

  • Protoplast regeneration protocols may need species-specific optimization

Due to these challenges, transient expression systems and heterologous complementation studies in model systems provide valuable alternatives for initial functional characterization.

What structural biology approaches are most promising for resolving cemA membrane topology?

Understanding cemA membrane topology requires specialized structural biology approaches suitable for membrane proteins:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for detergent-solubilized cemA

    • Electron crystallography for 2D crystals

    • Subtomogram averaging for in situ structural determination

    • Advantages: No crystal requirement, near-native conditions

    • Considerations: Protein size (>100 kDa preferred), conformational heterogeneity

  • X-ray crystallography adaptations:

    • Lipidic cubic phase crystallization

    • Fusion with crystallization chaperones (T4 lysozyme, BRIL)

    • In meso crystallization methods

    • Advantages: Potential atomic resolution

    • Considerations: Challenging crystallization, detergent screening critical

  • NMR-based approaches:

    • Solid-state NMR of reconstituted proteoliposomes

    • Solution NMR of solubilized domains in micelles

    • Selective isotope labeling strategies

    • Advantages: Dynamic information, no crystals required

    • Considerations: Size limitations, complex data interpretation

  • Hybrid/integrative methods:

    • Crosslinking mass spectrometry (XL-MS) to identify proximity relationships

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for solvent accessibility

    • FRET-based distance measurements between labeled residues

    • Computational modeling with experimental constraints

For cemA specifically, researchers should consider starting with topology prediction followed by experimental validation using cysteine scanning mutagenesis combined with membrane-impermeable labeling reagents. This approach can generate topological constraints for subsequent high-resolution structural studies.

How might cemA function in conifers be impacted by elevated atmospheric CO₂ under climate change scenarios?

Investigating cemA's role under elevated CO₂ conditions requires integrated physiological and molecular approaches:

  • Comparative transcriptomics:

    • RNA-Seq analysis of Pinus thunbergii under ambient vs. elevated CO₂

    • Focus on co-expression networks involving cemA

    • Time-course studies to capture acclimation responses

    • Multi-tissue analysis (needles, roots) to identify systemic effects

  • Protein-level responses:

    • Quantitative proteomics to measure cemA abundance changes

    • Post-translational modification analysis

    • Protein-protein interaction network alterations

    • Membrane complex stability assessments

  • Physiological measurements:

    • A/Ci curves to determine CO₂ response parameters

    • Chlorophyll fluorescence for photosynthetic efficiency

    • Isotope discrimination to assess carbon assimilation

    • Stomatal conductance and water-use efficiency changes

  • Long-term adaptation studies:

    • Free-Air CO₂ Enrichment (FACE) experiments with conifers

    • Transgenerational effects in seedling responses

    • Population genomics to identify cemA variants associated with climate adaptation

CO₂ ConcentrationPredicted cemA ResponsePhysiological ImpactExperimental Approach
Ambient (400 ppm)Baseline expressionStandard photosynthetic efficiencyControl measurements
Elevated (800 ppm)Potential downregulationIncreased photosynthetic rate, altered CCMGrowth chamber experiments
FluctuatingDynamic regulation patternsVariable water-use efficiencyProgrammed environmental chambers

Understanding cemA responses to elevated CO₂ can provide insights into conifer adaptation to climate change, particularly regarding carbon fixation efficiency and water relations under future atmospheric conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.