Recombinant Pinus thunbergii Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Pinus thunbergii (Japanese black pine) (Pinus thunbergiana)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLSYIFPVVILGTIACTIGLAVLEPS MIGEPANPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMGSVPAGSLTVPFLENVNQF QNPFRRPVATTVSLIGTAVALWLGIGAALPIDESLTLGLFQSNLIQLSNIKIFQFFYSYI
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the Cytochrome b6-f complex and what role does it play in photosynthesis?

    The Cytochrome b6-f complex is a critical component of the photosynthetic electron transport chain, functioning as an eight subunit, 220 kDa symmetric dimeric complex. According to structural studies, it serves as a key intermediary in electron transfer between photosystems, catalyzing plastoquinol oxidation at the Qp site.

    Research has revealed that the complex contains three plastoquinones that line up head-to-tail near the Qp site in each monomer, suggesting the existence of a dedicated channel. This arrangement supports a "one-way traffic model" that explains efficient quinol oxidation during photosynthesis, where quinones flow through the complex in one direction, transiently exposing their redox-active rings during catalysis .

    The complex includes several redox components:

    • Heme bn and cn (the latter not found in bc1 complexes)

    • Rieske [2Fe-2S] protein with a rubredoxin-like membrane proximal domain

    • Cytochrome f as an electron acceptor

    Activity measurements of purified Cytochrome b6-f complexes have demonstrated turnover rates of approximately 120 per second in plastocyanin reduction assays .

  • How is the petD gene organized in the Pinus thunbergii chloroplast genome?

    The petD gene in Pinus thunbergii is encoded in the chloroplast genome. Comparative genomic analyses with other Pinus species show that conifer chloroplast genomes are highly conserved in structure and gene content. In related pines like P. taeda, the complete chloroplast genome spans approximately 121,531 base pairs, with a typical structure containing:

    • A large single copy (LSC) region (~77,614 bp)

    • A small single copy (SSC) region (~42,258 bp)

    • A pair of inverted repeat (IR) regions (~830 bp each)

    The petD gene, encoding Cytochrome b6-f complex subunit 4, is part of the conserved set of chloroplast genes. The complete chloroplast genome typically encodes about 120 genes, including 81 protein-coding genes (petD among them), 4 rRNA genes, and 35 tRNA genes .

    Gene annotation is typically performed using tools like DOGMA with manual verification, and tRNA sequences are verified using programs such as tRNAscan-SE .

  • What expression systems are suitable for producing recombinant Pinus thunbergii petD protein?

    Several expression systems have been successfully employed for producing recombinant Cytochrome b6-f complex subunit 4 (petD) from Pinus thunbergii:

    1. Escherichia coli (E. coli): The most commonly used system, particularly BL21(DE3) strains, which allows for IPTG-inducible expression. This system has been used to produce recombinant petD with N-terminal His-tags for purification purposes .

    2. Yeast expression systems: Suitable for proteins requiring eukaryotic post-translational modifications.

    3. Baculovirus expression systems: Used when higher eukaryotic processing is needed.

    4. Mammalian cell expression: Employed for proteins requiring complex folding and mammalian-specific modifications.

    For petD specifically, E. coli expression has been documented to yield recombinant protein with greater than 85-90% purity as determined by SDS-PAGE. The recombinant protein is typically expressed with a His-tag to facilitate purification via Ni²⁺ affinity chromatography .

    A typical expression protocol includes:

    • Cloning the petD coding region into an expression vector like pET-15b

    • Transformation into E. coli BL21(DE3)

    • Induction with IPTG at 37°C

    • Harvesting and lysis of cells

    • Affinity purification of the His-tagged protein

    • Refolding if the protein forms inclusion bodies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.