Recombinant Pinus thunbergii Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Pinus thunbergii (Japanese black pine) (Pinus thunbergiana)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLISVHIMHTALVAGWAGSMTLYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGIKDSWSGWNITGETVINPGIWSYEGVAVAHIVFSGLCFLAAIWHWVYWDL DIFCDERTGKRCLDLPKVFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKIQP VDPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVRPPQRLYVGLRMGNIETVLSS SIAAVFFAAFIVAGTMWYGSATTPVELFGPTRYQWDQGYFQQEIDRRVRAGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHPIFKDKEGNELFVRRMP TFFETFPVVLVDKEGIVKADVPFRRAESKYSVEQVGVTVEFYGGGLDRVSFGDPAIVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFSGHIWHGARTLFRDVFA GIDSDLDDRIEFGAFQKLGDPTTKRQVV
Uniprot No.

Target Background

Function
CP47, a component of the core complex in photosystem II (PSII), plays a crucial role in light-driven water:plastoquinone oxidoreductase activity. It binds chlorophyll and facilitates the primary light-induced photochemical processes of PSII. PSII utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient, which subsequently drives ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the Photosystem II CP47 chlorophyll apoprotein (psbB) in Pinus thunbergii?

The CP47 chlorophyll apoprotein (encoded by the psbB gene) is a large structural component of the Photosystem II (PSII) complex found in the thylakoid membranes of Pinus thunbergii (Japanese black pine). This protein functions as a core antenna protein that binds multiple chlorophyll molecules and plays a crucial role in light harvesting and energy transfer to the PSII reaction center.

CP47 is essential for both the structural integrity and function of the PSII complex. In the stepwise assembly of PSII, the CP47 assembly module (CP47m) attaches to the Reaction Center II (RCII) complex to form a CP43-less core complex known as "RC47" . This intermediate then incorporates the CP43 module and lumenal extrinsic proteins to complete the fully functional oxygen-evolving PSII complex.

While sharing structural similarities with CP47 proteins from other photosynthetic organisms, the Pinus thunbergii variant may exhibit species-specific expression patterns and regulatory mechanisms, particularly regarding light responsiveness, as observed with other photosynthetic proteins in conifers.

  • How does the expression of photosystem components in Pinus thunbergii differ from other plant species?

The expression of photosystem components in Pinus thunbergii exhibits distinct regulatory patterns compared to angiosperms. Research on the chlorophyll a/b-binding protein (cab) gene in Pinus thunbergii has revealed that this gene is expressed in dark-grown seedlings at very high levels, which fundamentally differs from angiosperm cab genes that are strongly induced by light .

This light-independent gene expression appears to be characteristic of coniferous plant cab genes. Transcript mapping analyses show that the amount of cab mRNA in dark conditions is approximately half of that observed under light conditions . This suggests a unique evolutionary adaptation in the regulation of photosynthetic proteins in conifers.

CharacteristicPinus thunbergii (Conifer)Typical Angiosperms
Dark expressionHigh (≈50% of light levels)Low to negligible
Light regulationPartially light-independentStrongly light-dependent
Gene structureIntron at position equivalent to type II cab genesVariable intron positions
Evolutionary significanceAdaptation to conifer-specific environmental conditionsDifferent ecological adaptation

These expression differences likely extend to other photosystem components, including CP47, and have important implications for experimental design when working with recombinant proteins from Pinus thunbergii.

  • What are the optimal storage conditions for recombinant photosystem proteins?

Optimal storage of recombinant photosystem proteins such as CP47 is critical for maintaining structural integrity and functional activity. Based on established protocols for similar recombinant proteins, the following methodological approaches are recommended:

For long-term storage:

  • Store lyophilized protein at -20°C to -80°C immediately upon receipt

  • Perform aliquoting to avoid repeated freeze-thaw cycles which can significantly damage protein structure

  • Add 5-50% glycerol as a cryoprotectant when storing in solution form

For working solutions:

  • Store at 4°C for up to one week

  • Use appropriate buffer systems (typically Tris/PBS-based buffers at pH 8.0)

  • Include stabilizing agents such as trehalose (6%) to maintain protein conformation

Storage ConditionRecommended ProtocolPurpose
Long-term (-20°C/-80°C)Aliquot with 5-50% glycerolPrevent freeze-thaw damage
Short-term (4°C)Tris/PBS buffer with 6% trehaloseMaintain conformational stability
Stock concentration0.1-1.0 mg/mLOptimal protein stability

Importantly, repeated freeze-thaw cycles should be strictly avoided as they lead to protein denaturation, aggregation, and loss of functional activity, which is particularly problematic for structural studies and functional assays of membrane proteins like CP47.

  • How can I reconstitute lyophilized photosystem proteins for experimental use?

Proper reconstitution of lyophilized photosystem proteins like CP47 is essential for preserving structural integrity and functional properties. The following step-by-step methodological approach is recommended:

  • Centrifuge the vial briefly before opening to ensure all lyophilized material is collected at the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For subsequent experiments, consider the following buffer optimization:

    • For membrane protein studies: Add appropriate detergents to maintain solubility

    • For structural studies: Use buffers that maintain native conformation

    • For long-term storage: Add 5-50% glycerol as a cryoprotectant

  • Aliquot the reconstituted protein into smaller volumes to minimize freeze-thaw cycles

  • For working solutions, maintain at 4°C for up to one week

When preparing samples for specific experimental applications:

  • For spectroscopic studies: Minimize buffer components that may interfere with measurements

  • For crystallization trials: Remove cryoprotectants through dialysis or gel filtration

  • For functional assays: Ensure the buffer system supports the activity being measured

This methodological approach helps maintain the structural integrity of the CP47 protein and optimizes its utility for various experimental applications.

  • What is the role of CP47 protein in photosystem II assembly?

The CP47 protein plays a critical role in the stepwise assembly process of Photosystem II (PSII). According to established models, PSII is assembled from four preassembled smaller subcomplexes or modules, each consisting of one large chlorophyll-binding subunit and several low molecular mass membrane polypeptides .

The assembly sequence proceeds through these defined stages:

  • Initial association of D1 and D2 modules to form the Reaction Center II (RCII) complex

  • Attachment of the CP47 assembly module (CP47m) to RCII

  • Formation of a CP43-less core complex called "RC47"

  • Addition of the CP43 module

  • Attachment of lumenal extrinsic proteins to form the active, oxygen-evolving PSII complex

This assembly process requires numerous auxiliary proteins, many of which interact transiently with the assembly intermediates. For instance, the protein Pam68 has been shown to promote the insertion of CP47, with evidence suggesting it stabilizes membrane segments of CP47 and facilitates the incorporation of chlorophyll molecules into the translated CP47 polypeptide chain .

The sequential nature of this assembly process highlights the critical role of CP47 incorporation as a prerequisite for subsequent assembly steps, making it an essential checkpoint in PSII biogenesis.

Advanced Research Questions

  • How does light regulation affect the expression of photosystem components in Pinus thunbergii?

Light regulation of photosystem components in Pinus thunbergii involves complex mechanisms that operate at both transcriptional and translational levels. This dual regulation represents a sophisticated control system that differs significantly from that observed in angiosperms.

At the transcriptional level, the cab gene (encoding chlorophyll a/b-binding protein) in Pinus thunbergii shows remarkable expression in dark-grown seedlings, with mRNA levels approximately 50% of those observed under light conditions . This contrasts sharply with the strong light dependency observed in angiosperms and represents a fundamental difference in regulatory mechanisms.

At the translational level, studies on polysome formation reveal a phytochrome-mediated control mechanism:

ConditionPolysome LevelResponse TimingSignificance
Dark imbibitionVery low (primarily free ribosomes)Maintained for at least one monthTranslation suppressed despite mRNA presence
Red light exposureSignificantly increasedWithin 4 hours post-exposureRapid translational activation
Red followed by far-redPartially reversedImmediateConfirms phytochrome mediation

This indicates that while conifer photosynthetic genes maintain significant expression in darkness, the translation of their mRNAs remains under light control through phytochrome-mediated regulation of polysome assembly. This mechanism allows for rapid adaptation to changing light conditions while maintaining baseline transcript levels, representing an evolutionary adaptation potentially beneficial in conifer forest understory environments.

  • What experimental approaches can be used to study CP47 protein interactions during photosystem II assembly?

Studying CP47 protein interactions during Photosystem II assembly requires sophisticated experimental approaches that can capture both stable and transient protein associations. Several complementary methodologies have proven effective:

Native Protein Complex Analysis
2D Clear Native/SDS-PAGE combined with immunoblotting allows visualization of CP47-containing complexes:

  • Isolate thylakoid membranes using differential centrifugation

  • Solubilize membranes with mild detergents (e.g., n-dodecyl β-D-maltoside)

  • Separate protein complexes by Clear Native PAGE

  • Run second-dimension SDS-PAGE to separate complex components

  • Perform immunoblotting with specific antibodies

Co-immunoprecipitation and Pull-down Assays
For identifying interaction partners:

  • Generate tagged versions of CP47 (e.g., His-tagged)

  • Express in appropriate systems (e.g., E. coli as demonstrated with Welwitschia mirabilis CP47)

  • Perform affinity purification under conditions that preserve protein-protein interactions

  • Identify co-purified proteins using mass spectrometry

Fluorescence-based Interaction Studies
For quantitative analysis of protein interactions:

  • Fluorescence resonance energy transfer (FRET) between labeled proteins

  • Bimolecular fluorescence complementation (BiFC) for in vivo interaction detection

  • Fluorescence correlation spectroscopy (FCS) for dynamic interaction analysis

Crosslinking Mass Spectrometry
For capturing transient interactions:

  • Apply chemical crosslinkers to stabilize protein-protein interactions

  • Digest crosslinked complexes with proteases

  • Identify crosslinked peptides by mass spectrometry

  • Map interaction interfaces at amino acid resolution

These complementary approaches can provide a comprehensive understanding of the CP47 interactome during PSII assembly, revealing both the stable architectural interactions and the transient associations with assembly factors.

  • How can mutations in the CP47 protein affect photosystem II function under various ionic conditions?

Mutations in the CP47 protein can significantly alter Photosystem II function, particularly under varying ionic conditions. Research on the R448S mutation (arginine to serine substitution at position 448) has provided valuable insights into structure-function relationships in CP47.

The R448S mutant exhibits a specific defect in its ability to assemble functional PSII reaction centers under chloride-limiting conditions . Detailed analysis of oxygen evolution under different chloride concentrations reveals distinctive functional characteristics:

ParameterControl StrainR448S MutantSignificance
Loss of O₂ evolution under Cl⁻-limiting conditions (t₁/₂)16 min17 minSimilar initial deactivation
Recovery of O₂ evolution upon Cl⁻ addition (t₁/₂)50 sec308 sec~6× slower reactivation
PSII assembly under Cl⁻-limiting conditionsNormalDefectiveIndicates structural role

The significantly slower reactivation kinetics in the R448S mutant suggests a defect at the low-affinity, rapidly exchanging chloride-binding site . This has important methodological implications for studying CP47 mutations:

  • Differential ionic testing: Mutations may only manifest phenotypes under specific ionic conditions

  • Time-resolved measurements: Kinetic analysis can reveal defects not apparent in steady-state measurements

  • Structure-function correlation: The R448 position likely plays a role in forming or stabilizing a chloride-binding site

  • Evolutionary conservation analysis: Examination of this residue across species can provide insights into its importance

These findings demonstrate how single amino acid substitutions in CP47 can have profound effects on PSII function through alterations in ion binding rather than through gross structural changes. This understanding can guide the design of recombinant CP47 variants for structure-function studies and help interpret naturally occurring variations in this protein across species.

  • What methods can be used to analyze the integration of chlorophyll molecules into the CP47 protein?

Analyzing chlorophyll integration into the CP47 protein requires specialized techniques that can probe both the structural aspects and the dynamics of this process. Several complementary methodological approaches are particularly valuable:

Biochemical Analysis of Assembly Intermediates
Studies suggest that proteins like Pam68 stabilize membrane segments of CP47 and facilitate chlorophyll insertion into the translated polypeptide chain . To investigate this:

  • Isolate ribosome-nascent chain complexes during CP47 synthesis

  • Identify co-purifying assembly factors using mass spectrometry

  • Analyze chlorophyll content at different stages of translation

  • Use pulse-chase experiments with labeled chlorophyll precursors

Spectroscopic Analysis of Chlorophyll-Protein Interactions

TechniqueInformation ProvidedMethodological Considerations
Absorption SpectroscopyChlorophyll binding environmentCompare spectra before/after reconstitution with chlorophyll
Circular DichroismPigment organization and protein structureSensitive to changes in chlorophyll orientation
Fluorescence SpectroscopyEnergy transfer between chlorophyllsCan detect subtle changes in chlorophyll-chlorophyll interactions
Resonance RamanSpecific chlorophyll-protein interactionsRequires specialized equipment but offers high specificity

Structural Approaches
For detailed visualization of chlorophyll binding sites:

  • X-ray crystallography or cryo-electron microscopy of CP47-containing complexes

  • Molecular dynamics simulations to predict chlorophyll binding and stability

  • Hydrogen-deuterium exchange mass spectrometry to identify regions involved in chlorophyll binding

Genetic Approaches
To determine the importance of specific residues:

  • Generate site-directed mutations in predicted chlorophyll-binding sites

  • Express and purify mutant proteins (similar to the His-tagged approach used for Welwitschia mirabilis CP47)

  • Analyze chlorophyll content and spectroscopic properties

  • Perform functional reconstitution assays

The co-translational nature of chlorophyll incorporation, facilitated by assembly factors like Pam68 , suggests that experimental designs should focus on capturing assembly intermediates rather than solely analyzing the final assembled protein. This requires careful timing of sample collection and preservation of the native membrane environment whenever possible.

  • How does polysome formation in Pinus thunbergii relate to translation of photosystem components?

Polysome formation in Pinus thunbergii represents a critical regulatory mechanism for controlling the translation of photosynthetic proteins, including Photosystem II components. Research on polysome dynamics in Pinus thunbergii embryos reveals sophisticated light-dependent translational control.

Studies have characterized distinct ribosomal populations in Pinus thunbergii:

  • Free ribosomes: Dissociate into smaller subunits in high salt buffer

  • Complex ribosomes: Remain intact in high salt buffer

  • Monomer ribosomes derived from polysomes after RNase treatment

The dynamics of polysome formation show strong phytochrome-mediated regulation:

ConditionPolysome LevelObservationImplication for Research
Dark-imbibed seedsVery lowPredominantly free ribosomesTranslation minimized despite mRNA presence
Prolonged dark (≤1 month)Remains very lowNo spontaneous increaseStable suppression mechanism
4h after red lightSignificantly increasedRapid polysome formationCoordinated translational activation
Red → far-red lightPartially decreasedPhytochrome-mediated reversibilityTool for experimental manipulation

This light-regulated polysome formation mechanism has several important implications for studying photosystem components:

  • Transcription-translation uncoupling: The presence of substantial mRNA levels in darkness (as seen with cab genes) combined with minimal polysome formation indicates post-transcriptional regulation

  • Methodological considerations: When isolating photosystem components from Pinus thunbergii:

    • Light conditions during growth significantly impact protein synthesis

    • Red light pre-treatment (4+ hours) maximizes translation

    • Dark-grown material may have reduced levels of newly synthesized proteins

  • Experimental applications: The red/far-red reversibility provides an experimental tool to manipulate translation rates without changing transcription

  • Evolutionary significance: This mechanism may represent an adaptation allowing conifers to maintain transcript pools ready for rapid translation upon light exposure, potentially advantageous in forest understory environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.