Recombinant Pinus thunbergii Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pinus thunbergii Photosystem II D2 Protein (psbD)

Recombinant Pinus thunbergii Photosystem II D2 protein (psbD) is a heterologously expressed version of the D2 subunit integral to Photosystem II (PSII) in Japanese black pine. This protein, encoded by the psbD gene (UniProt ID: P41644), is critical for PSII’s structural integrity and function in oxygenic photosynthesis . Produced in E. coli with an N-terminal His tag, the recombinant variant retains full-length sequence fidelity (1–353 amino acids) and is utilized for biochemical and biophysical studies .

Role in PSII Assembly

  • PsbD forms a heterodimer with D1 (psbA), creating the PSII reaction center core .

  • Essential for stabilizing the Mn4_4CaO5_5 cluster in the water-splitting complex .

  • Binds cofactors such as pheophytin, plastoquinone (QA_A), and non-heme iron .

Key Studies Utilizing Recombinant psbD

Study FocusFindingsSource
PSII BiogenesisPsbD accumulation is a rate-limiting step for PSII reaction center assembly. Deletion of psbD disrupts CP43/CP47 binding .
Stress ResponseResistant P. thunbergii upregulates psbD during pine wood nematode infection, linking PSII stability to pathogen defense .
Structural InsightsCryo-EM studies reveal PsbD’s conformational flexibility during CP43/CP47 integration and photodamage repair .

Comparative Analysis with Homologs

FeatureP. thunbergii psbDCyanobacterial psbDHigher Plant psbD
Molecular Weight~39.5 kDa~39.5 kDa~39.5 kDa
Conservation98% identity with angiosperms85% identity95–98% identity
Functional RoleStabilizes Mn4_4CaO5_5 clusterBinds Psb28 during assemblyInteracts with PsbO/PsbP

Challenges and Future Directions

  • Instability: Recombinant psbD requires glycerol (5–50%) for long-term storage due to aggregation risks .

  • Research Gaps: Limited structural data on pine-specific PSII complexes; most insights derive from cyanobacterial or Arabidopsis models .

  • Biotechnological Potential: Engineered psbD variants could enhance PSII resilience in transgenic pines against biotic/abiotic stress .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format we have in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes section, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for accurate delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We aim to provide the most appropriate tag type during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Pinus thunbergii (Japanese black pine) (Pinus thunbergiana)
Target Names
psbD
Target Protein Sequence
MTIALGKSSKEEKTLFDTVDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDLTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPESETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O, generating O(2) and a proton gradient which subsequently drives ATP formation. It consists of a core antenna complex responsible for photon capture and an electron transfer chain that transforms photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors. D2 is essential for the assembly of a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of D2 protein (PsbD) in Photosystem II?

The D2 protein (PsbD) forms the reaction core of Photosystem II (PSII) as a heterodimer with the D1 protein (PsbA). With a molecular mass of approximately 39.5 kDa, D2 is slightly larger than D1 but shares significant homology . Research in cyanobacteria has demonstrated that D2 accumulation is a key regulatory step for D1 accumulation and the consecutive assembly of the PSII reaction center complex . Without D2, other proteins such as D1, CP47, and cytochrome b559 cannot form mutual complexes, indicating that assembly of the reaction center complex is a prerequisite for assembly with core subunits CP47 and CP43 . The complete amino acid sequence for P. thunbergii D2 protein begins with "MTIALGKSSKEEKTLFDTVDD..." and continues for 353 amino acids .

How is psbD gene expression regulated in P. thunbergii compared to other plants?

Regulation of psbD expression in P. thunbergii involves complex light and stress responses that differ from those in angiosperms. While the gene structure includes a well-conserved AAG-box containing promoter (similar to other gymnosperms), the response to light is intensity-dependent. Studies show that high light exposure (245 μmolm-2s-1) induces transient expression of psbD in P. thunbergii, whereas moderate light (180 μmolm-2s-1) does not activate psbD expression .

This differs significantly from angiosperms, where light-induced psbD expression is well-documented in both eudicots (Cucumis sativus, Arabidopsis thaliana, and Lactuca sativa) and monocots (wheat and maize) . In Arabidopsis, the psbD gene is under the control of a unique blue light responsive promoter (BLRP) that is transcribed by a bacterial-type plastid RNA polymerase (PEP), with promoter recognition mediated by nuclear-encoded sigma factors, particularly AtSig5 . The divergent regulatory mechanisms across plant lineages suggest that light and stress-induced transcription mechanisms have evolved independently multiple times during land plant evolution .

What methodological approaches are used to study P. thunbergii psbD expression in response to environmental stresses?

Researchers employ several complementary methods to study psbD expression in P. thunbergii under stress conditions:

  • Transcriptome analysis (RNA-seq): This approach allows comprehensive examination of gene expression patterns. In studies of pine wilt disease resistance, RNA samples collected from shoots of inoculated pines throughout infection phases revealed that resistant P. thunbergii trees exhibited different psbD expression patterns compared to susceptible trees .

  • Real-time quantitative PCR (RT-qPCR): This method enables precise quantification of psbD expression changes under various conditions, such as different light intensities or stress treatments.

  • Comparative transcriptomics: Comparing transcriptional profiles between resistant and susceptible P. thunbergii lines has revealed that resistant trees stimulate more differential expression genes (DEGs) and involve more regulatory pathways than susceptible trees . This approach has been particularly informative for understanding pine wilt disease resistance mechanisms.

  • Time-course experiments: Studies have shown that psbD expression changes dynamically over time following stress exposure, with maximum DEGs occurring at specific timepoints (e.g., 7 days post-inoculation with pine wood nematode) .

  • Pathway enrichment analysis: KEGG pathway analysis has identified enriched biological pathways related to stress responses in P. thunbergii, providing context for understanding psbD regulation within broader cellular processes .

How do evolutionary changes in psbD promoter structure correlate with functional differences in light responsiveness across plant lineages?

The psbD promoter structure shows remarkable conservation across plant lineages, yet its functional response to light varies significantly, presenting an evolutionary paradox. In P. thunbergii and other gymnosperms, the psbD promoter contains a well-conserved AAG-box, similar to that found in angiosperms . This AAG-box consists of two repeat units (AAGT and GACC/T repeats) that are important for transcription in many plants.

Intriguingly, despite this structural conservation, the functional response to light differs dramatically. Gymnosperms like P. thunbergii show only transient psbD expression under high light conditions (245 μmolm-2s-1), while many angiosperms exhibit robust light-induced expression . This functional divergence suggests that the trans-acting factors that interact with the psbD promoter, rather than the cis-elements themselves, may have evolved differently across plant lineages.

Phylogenetic analyses of chloroplast genomes across land plants have revealed that certain genes, including psbD, show unusual evolutionary patterns. For instance, in Pinus species, a disproportionate amount of phylogenetic information resides in two loci (ycf1, ycf2), highlighting their unusual evolutionary properties . Similar evolutionary dynamics may apply to the regulatory machinery of psbD.

Research in Arabidopsis has identified AtSig5 as a key sigma factor essential for psbD BLRP activity , but the extent to which similar regulatory mechanisms exist in gymnosperms remains unclear. The convergent evolution of light-responsive mechanisms across distant plant lineages suggests multiple independent origins of this regulatory capability, despite the conservation of promoter structure.

What experimental approaches best detect functional differences between wild-type and recombinant P. thunbergii psbD protein?

To rigorously detect functional differences between wild-type and recombinant P. thunbergii psbD protein, researchers should implement a multi-level experimental approach:

  • Structural analysis:

    • Circular dichroism spectroscopy to compare secondary structure elements

    • Protein crystallography or cryo-EM to assess tertiary structure similarities and differences

    • Size exclusion chromatography to evaluate oligomerization properties and interaction with D1 protein

  • Biochemical characterization:

    • Binding assays for chlorophylls, carotenoids, and metal cofactors

    • Redox potential measurements of electron transfer components

    • Thermal stability analyses using differential scanning fluorimetry

  • Functional assays:

    • Oxygen evolution measurements in reconstituted systems

    • Electron transport rate determination using artificial electron acceptors

    • Chlorophyll fluorescence induction curves to assess energy transfer efficiency

    • Reactive oxygen species (ROS) production under photoinhibitory conditions

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with D1 protein and other PSII components

    • Surface plasmon resonance to quantify binding kinetics

    • Chemical cross-linking followed by mass spectrometry to map interaction interfaces

  • Complementation experiments:

    • Introduction of recombinant psbD into mutant systems lacking functional D2 protein

    • Assessment of PSII assembly and function in complemented systems

    • Competition experiments between wild-type and recombinant proteins

Studies in cyanobacteria have demonstrated that psbDII-inactivated mutants consistently formed small colonies and competed poorly in mixed-culture experiments , suggesting that functional complementation assays provide sensitive indicators of D2 protein functionality.

How can contradictory findings about psbD stress responses be reconciled across different experimental systems?

Contradictory findings regarding psbD stress responses across experimental systems can be systematically reconciled through the following approaches:

  • Standardize experimental conditions: Studies of psbD in P. thunbergii have shown that light responses are threshold-dependent, with expression occurring only above specific intensities (245 μmolm-2s-1) . Standardizing light intensities, stress durations, and sampling timepoints is essential for meaningful comparisons.

  • Consider genetic background effects: Research demonstrates that resistant and susceptible P. thunbergii genotypes show dramatically different transcriptional responses to pine wood nematode infection . The genetic background, including potential QTLs like PWD1 identified in P. thunbergii , may significantly influence psbD regulation under stress.

  • Address temporal dynamics: Time-course analyses in P. thunbergii revealed that maximum differential gene expression occurred at 7 days post-inoculation (10,041 DEGs), while the lowest number occurred at 14 days post-inoculation (6,316 DEGs) . Single-timepoint studies might capture different phases of the response, leading to apparently contradictory results.

  • Examine pathway context: Pathway enrichment analyses have shown that different stress conditions activate distinct signaling networks. For example:

Host of PWN1 d vs. 3 d3 d vs. 7d
Susceptible P. thunbergiiMAPK signaling pathway—plant (p=0.0053)alpha-Linolenic acid metabolism (p=0.0064)
Resistant P. thunbergiiMAPK signaling pathway—plant (p<0.001)Cutin, suberine and wax biosynthesis (p<0.001)
Plant–pathogen interaction (p<0.001)Photosynthesis—antenna proteins (p<0.001)
  • Apply meta-analysis techniques: Formal statistical meta-analysis of multiple studies can identify consistent patterns while accounting for between-study heterogeneity.

By implementing these approaches, researchers can distinguish genuine biological differences from methodological artifacts, thereby resolving apparent contradictions in psbD research.

What protocols are recommended for efficient expression and purification of recombinant P. thunbergii psbD protein?

For efficient expression and purification of recombinant P. thunbergii psbD protein, researchers should consider the following optimized protocol:

  • Expression system selection:

    • E. coli-based systems: While commonly used, they may struggle with proper folding of membrane proteins like D2.

    • Insect cell expression systems (Sf9, Hi5): Better suited for membrane proteins, providing improved folding and post-translational modifications.

    • Cell-free expression systems: Useful for toxic membrane proteins, allowing direct incorporation into detergent micelles or liposomes.

  • Construct design considerations:

    • The full amino acid sequence (353 amino acids) for P. thunbergii D2 protein should be used as the template .

    • Codon optimization for the chosen expression system improves yield.

    • N-terminal or C-terminal tags should be carefully positioned to avoid interfering with protein folding or function.

    • Consider including a cleavable tag system (TEV protease site) for tag removal after purification.

  • Solubilization and extraction protocol:

    • For membrane proteins like D2, efficient solubilization is critical.

    • Test multiple detergents (DDM, LMNG, SMA copolymers) for optimal extraction efficiency.

    • A typical membrane protein extraction protocol includes:
      a) Cell lysis via sonication or mechanical disruption
      b) Low-speed centrifugation to remove cell debris
      c) High-speed ultracentrifugation to isolate membrane fraction
      d) Detergent solubilization of membrane fraction (typically 1-2% detergent)
      e) Another ultracentrifugation step to remove insoluble material

  • Chromatography strategy:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Intermediate purification: Ion exchange chromatography based on D2 protein's theoretical pI

    • Polishing: Size exclusion chromatography to separate monomeric D2 from aggregates and to exchange into final buffer

  • Storage recommendations:

    • Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage .

    • Avoid repeated freeze-thaw cycles; prepare single-use aliquots.

    • Working stocks can be maintained at 4°C for up to one week .

  • Quality control:

    • SDS-PAGE and Western blot using Anti-PsbD (D2) GLOBAL ANTIBODY to confirm identity and purity.

    • Mass spectrometry to verify protein integrity.

    • Circular dichroism to assess secondary structure.

    • Thermal shift assays to verify proper folding.

This protocol has been adapted based on successful approaches for membrane protein purification and specific information available for P. thunbergii D2 protein.

How should knockout or gene silencing experiments targeting psbD be designed in P. thunbergii?

Designing effective knockout or gene silencing experiments targeting psbD in P. thunbergii requires careful consideration of several factors:

  • Gene redundancy assessment:

    • Before attempting gene modification, determine if P. thunbergii has multiple copies of psbD. Studies in cyanobacteria revealed two functional copies (psbDI and psbDII) , and similar redundancy may exist in P. thunbergii.

    • Perform genome or chloroplast genome sequencing to identify all psbD copies.

    • Design targeting strategies that account for potential sequence variations between copies.

  • Gene structure and operon organization considerations:

    • The psbD gene is often co-transcribed with psbC in an operon structure . Disruption of psbD may affect psbC expression.

    • In cyanobacterial studies, researchers engineered a strain expressing psbC from an alternative locus before inactivating psbDI . Similar approaches may be necessary for P. thunbergii.

    • Target design must consider the potential for polar effects on downstream genes.

  • Transformation strategy selection:

    • For plastid-encoded genes like psbD, plastid transformation is preferred over nuclear transformation.

    • Options include:
      a) Biolistic transformation of embryogenic cultures
      b) Agrobacterium-mediated plastid transformation
      c) CRISPR/Cas9-based approaches adapted for chloroplast genomes

    • Leverage established somatic embryogenesis systems for P. thunbergii to enhance transformation efficiency.

  • Conditional or inducible systems:

    • Given the essential nature of D2 protein, complete knockout may be lethal.

    • Consider inducible promoter systems to control the timing of gene silencing.

    • Temperature-sensitive or chemical-inducible systems allow for temporal control of gene expression.

  • RNAi or antisense approaches:

    • For partial silencing, design RNAi constructs targeting unique regions of psbD.

    • Antisense RNA approaches can provide variable levels of gene silencing.

    • Test multiple constructs targeting different regions of the transcript.

  • Screening and validation strategy:

    • Primary screening: PCR-based genotyping to confirm transformation

    • Molecular validation: RT-qPCR to quantify transcript levels

    • Protein-level confirmation: Western blot using Anti-PsbD (D2) GLOBAL ANTIBODY

    • Functional assessment: Chlorophyll fluorescence measurements to evaluate PSII activity

  • Control inclusion:

    • Include wild-type P. thunbergii as negative control

    • Use transformation with non-targeting constructs as technical controls

    • Generate a range of lines with varying degrees of silencing to establish dose-response relationships

Studies in cyanobacteria showed that psbDI-inactivated mutants formed small colonies and competed poorly in mixed-culture experiments , suggesting that even partial reduction in D2 function may produce detectable phenotypes that can be used for screening transformants.

What experimental designs are most effective for studying the interaction between light conditions and stress responses in psbD regulation?

To effectively study the interaction between light conditions and stress responses in psbD regulation in P. thunbergii, the following experimental design elements are recommended:

This experimental design allows for robust analysis of both main effects and interaction effects between light conditions and stress responses in psbD regulation, providing a comprehensive understanding of the complex regulatory mechanisms in P. thunbergii.

How should RNA-seq data be analyzed to identify regulatory networks controlling psbD expression under stress?

Analyzing RNA-seq data to identify regulatory networks controlling psbD expression under stress in P. thunbergii requires a comprehensive bioinformatic approach:

  • Quality control and preprocessing:

    • Assess raw read quality using FastQC

    • Trim low-quality bases and adapter sequences

    • Filter contaminating sequences

    • Verify sufficient sequencing depth (typically >20 million reads per sample)

  • Reference selection and read mapping:

    • In the absence of a complete P. thunbergii genome, use available chloroplast genome sequences

    • Consider de novo transcriptome assembly if reference is incomplete

    • Map reads using splice-aware aligners (STAR, HISAT2)

    • Validate mapping statistics (typically >70% mapping rate expected)

  • Differential expression analysis:

    • Normalize count data to account for sequencing depth and composition bias

    • Apply appropriate statistical models (DESeq2, edgeR) for differential expression analysis

    • Use time-course-specific methods for temporal data analysis

    • Implement stringent criteria for DEG identification (adjusted p-value <0.05, log2FC >1)

  • Co-expression network construction:

    • Build gene co-expression networks using WGCNA or similar algorithms

    • Identify modules of co-expressed genes containing psbD

    • Analyze module preservation across different conditions

    • Identify hub genes within psbD-containing modules

  • Pathway enrichment analysis:

    • Perform KEGG pathway analysis to identify enriched biological pathways

    • Research on P. thunbergii has identified key pathways activated under stress, including:

      • MAPK signaling pathway—plant (p<0.001)

      • Linoleic acid metabolism (p<0.001)

      • Plant–pathogen interaction (p<0.001)

      • Photosynthesis—antenna proteins (p<0.001)

  • Transcription factor binding site analysis:

    • Identify promoter regions of co-expressed genes

    • Perform motif enrichment analysis to identify common regulatory elements

    • Compare with known regulatory elements like the AAG-box in the psbD promoter

  • Temporal dynamics analysis:

    • Apply time-series clustering methods to identify genes with similar expression patterns

    • Use change-point detection algorithms to identify significant shifts in expression

    • Implement dynamic regulatory network inference to model temporal changes in regulation

  • Integration with external datasets:

    • Combine RNA-seq data with available ChIP-seq, proteomics, or metabolomics data

    • Use multi-omics integration methods (MOFA+, DIABLO) to identify coordinated responses

    • Leverage publicly available data for comparative analysis

  • Validation of key findings:

    • Confirm expression patterns of key genes using RT-qPCR

    • Validate protein-level changes of important regulators

    • Test predicted regulatory relationships through targeted experiments

This comprehensive analytical framework has been successfully applied in P. thunbergii research, revealing that resistant trees show distinct transcriptional profiles compared to susceptible trees, with different sets of genes and pathways activated at different timepoints following stress exposure .

What comparative genomics approaches best identify conserved regulatory elements in psbD across conifer species?

To effectively identify conserved regulatory elements in psbD across conifer species, researchers should implement these specialized comparative genomics approaches:

  • Multiple sequence alignment of promoter regions:

    • Collect psbD promoter sequences from diverse conifer species, including P. thunbergii

    • Perform phylogenetically-aware multiple sequence alignment using MAFFT, MUSCLE, or T-Coffee

    • Focus particularly on the 200-300 bp upstream region that typically contains regulatory elements

    • Pay special attention to the AAG-box region, which contains AAGT and GACC/T repeats that are important for transcription

  • Phylogenetic footprinting:

    • Compare aligned sequences across evolutionary distances to identify highly conserved motifs

    • Implement methods that account for the slower evolutionary rate of conifers compared to angiosperms

    • Use tools like PhyloP or GERP to detect sequences under evolutionary constraint

    • Research has shown that gymnosperms like P. thunbergii have well-conserved AAG-box containing psbD promoters, despite functional differences in light responsiveness

  • Motif discovery and enrichment analysis:

    • Apply de novo motif discovery algorithms (MEME, STREME) to identify common sequence patterns

    • Perform enrichment analysis to determine which motifs are statistically overrepresented

    • Compare identified motifs with known plant transcription factor binding sites

    • Evaluate conservation of spacing and orientation between motifs

  • Structural conservation analysis:

    • Analyze DNA shape features (minor groove width, helix twist) that may be conserved despite sequence divergence

    • Predict DNA accessibility and nucleosome positioning across promoter regions

    • Examine conservation of CpG islands or other epigenetic regulatory features

    • Consider 3D chromatin organization that might affect promoter accessibility

  • Functional element validation:

    • Integrate comparative genomic predictions with experimental data on transcription factor binding

    • Correlate conserved elements with known regulatory functions across species

    • Use published data on light-responsiveness of psbD across plant lineages to identify potential functional regulatory elements

  • Whole chloroplast genome context:

    • Consider the genomic context of psbD, including its organization in operons

    • Research has shown that in many species, psbD overlaps with or is co-transcribed with psbC

    • Analyze the conservation of operon structure and potential long-range regulatory elements

    • Examine whether gene rearrangements in the chloroplast genome correlate with changes in gene regulation

  • Evolutionary rate analysis:

    • Calculate substitution rates in different regions of the psbD locus across conifer species

    • Compare these rates with those of other chloroplast genes to identify unusual evolutionary patterns

    • Research on Pinus species has shown that certain chloroplast genes, like ycf1 and ycf2, exhibit unusual evolutionary properties , and similar analyses could reveal important patterns for psbD

  • Bayesian phylogenetic approaches:

    • Implement Bayesian methods to reconstruct ancestral sequences of regulatory regions

    • Identify lineage-specific changes that might explain functional differences

    • Use statistical tests to distinguish neutral evolution from selection on regulatory elements

These approaches collectively provide a robust framework for identifying conserved regulatory elements in psbD across conifer species, while accounting for the unique evolutionary history and genome characteristics of these ancient plant lineages.

How can researchers develop predictive models for psbD expression under combined light and stress conditions?

Developing predictive models for psbD expression under combined light and stress conditions in P. thunbergii requires integration of multiple data types and advanced modeling approaches:

A successful example from P. thunbergii research involved identifying differential responses between resistant and susceptible genotypes. Studies showed that resistant P. thunbergii activated different gene sets and pathways compared to susceptible trees when challenged with pine wood nematode, including higher expression of ROS-regulated genes (three DEGs for RBOH at 1 dpi and six at 3 dpi) . Similar modeling approaches could predict how different P. thunbergii genotypes might respond to combined light and stress conditions, informing both basic research and applied breeding efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.