Recombinant Pipistrellus abramus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

What is the structure and function of NADH-ubiquinone oxidoreductase chain 4L in Pipistrellus abramus?

MT-ND4L is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. It is part of the enzyme membrane arm embedded in the lipid bilayer and is involved in proton translocation . The protein consists of 98 amino acids with the sequence: MSLTYFNVMLAFTMSFLGLLMYRSHLMSSLLCLEGLMLSLFVLVTITILITHSTLNSMLPIILLVFAACEAALGLSLLVAVSNTYGLDHVQNLNLLKC . This highly hydrophobic protein contains multiple transmembrane domains that anchor it within the inner mitochondrial membrane.

How does the amino acid sequence of P. abramus MT-ND4L compare to that of other species?

The amino acid sequence of P. abramus MT-ND4L shows considerable conservation compared to other mammalian species, particularly in transmembrane domains. When compared with other species like Nyctomys sumichrasti (MTLVMFNITIAFTLSLLGTLMFRTHLMSTLLCLEGMMLCLFIMAVITSLDTHPMIMYPIPIIILVFAACEAAVGLALLAMVSSTYGTDYVQNLNLLQC) and Arctocephalus forsteri (MSMVYFNIFMAFTVSFVGLLMYRSHLMSSLLCLEGMMLSLFVMMSMTILNNHFTLASMAPIILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC) , we observe conservation of key functional residues while accommodating species-specific variations. This conservation pattern is typical of mitochondrially-encoded proteins that perform essential functions in cellular respiration.

Table 1: Comparison of MT-ND4L amino acid sequences across selected species

What expression systems are most effective for producing recombinant P. abramus MT-ND4L?

The most commonly used expression system for recombinant P. abramus MT-ND4L is E. coli, though yeast, baculovirus, and mammalian cell systems are also employed depending on research requirements . E. coli offers high yield and cost efficiency, while mammalian systems provide more authentic post-translational modifications. For structural studies requiring high purity, E. coli expression systems with His-tagging have proven most effective, achieving greater than 90% purity as determined by SDS-PAGE .

For optimal expression in E. coli:

• Use codon-optimized sequences for E. coli expression

• Employ low temperature induction (16-18°C) to reduce inclusion body formation

• Include detergents such as n-dodecyl-β-D-maltoside (DDM) in purification buffers to maintain protein solubility

• Utilize N-terminal fusion tags (His6) for affinity purification while minimizing interference with protein function

What are the optimal conditions for storing and handling recombinant P. abramus MT-ND4L?

For optimal stability and activity, recombinant P. abramus MT-ND4L should be stored at -20°C/-80°C for long-term storage, with aliquoting necessary to avoid repeated freeze-thaw cycles . For working solutions, store aliquots at 4°C for up to one week . The recommended reconstitution protocol involves:

• Briefly centrifuge the vial prior to opening

• Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 50% for long-term storage

• Store aliquots at -20°C/-80°C

The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which enhances stability during freeze-thaw cycles .

How can researchers assess the functional activity of recombinant P. abramus MT-ND4L in experimental settings?

Functional assessment of recombinant P. abramus MT-ND4L requires integration into a membrane environment that mimics its native mitochondrial context. Several methodological approaches have demonstrated success:

• Membrane reconstitution assays: Incorporate the recombinant protein into liposomes or nanodiscs with other Complex I components and measure:

  • NADH oxidation rates using spectrophotometric assays monitoring NADH absorbance at 340 nm

  • Reduction of artificial electron acceptors like ferricyanide

  • Proton translocation using pH-sensitive probes

• Inhibitor binding studies: Assess interaction with specific inhibitors like NADH-OH, which has been shown to block FMN-dependent reactions with a Ki of 1 nM in competitive inhibition assays . This provides valuable information on the protein's active site accessibility and conformational state.

• Reverse electron transfer assays: Measure succinate-driven reverse electron transfer to hexaammineruthenium (III), which has been shown to interact with non-FMN redox groups in Complex I .

An important control is to compare results with the well-characterized P. denitrificans enzyme, as studies have shown similar inhibitor responses between mammalian and bacterial Complex I components .

What approaches are being used to investigate the role of P. abramus MT-ND4L in adaptive evolution?

Studies investigating adaptive evolution in P. abramus MT-ND4L employ several complementary approaches:

• Sequence-based selection analyses: Comparing nonsynonymous vs. synonymous substitution rates (dN/dS) between P. abramus populations from different geographic regions. Research has shown that while mitochondrial genes generally experience strong purifying selection, MT-ND4L can undergo positive selection when nonsynonymous substitutions cause radical changes in amino acid physicochemical properties .

• Population genomics approaches: Analysis of cyto-nuclear discordance (differences between mitochondrial and nuclear DNA patterns) in P. abramus across mainland China and Hainan Island has revealed evidence of mitochondrial DNA introgression, suggesting adaptive events in mitochondrial genes .

• Functional comparative studies: Experimental comparison of enzyme activities between variants can determine if amino acid changes affect:

  • Catalytic efficiency

  • Thermostability

  • pH optima

  • Resistance to oxidative stress

These approaches have revealed that while closely related taxa show strong conservation of mitochondrial genes due to their critical role in oxidative metabolism, metabolic requirements vary across climatic and ecological gradients, modifying selective pressures on genes like MT-ND4L .

How are AI-driven approaches enhancing structural and functional understanding of P. abramus MT-ND4L?

Advanced computational approaches are transforming research on proteins like P. abramus MT-ND4L:

• AI-powered literature research: Custom-tailored large language models (LLMs) efficiently extract and formalize information about the protein from structured and unstructured data sources, generating knowledge graphs that reveal therapeutic significance, known ligands, and protein-protein interactions .

• AI-driven conformational ensemble generation: Starting from initial protein structures, AI algorithms predict alternative functional states of MT-ND4L, including large-scale conformational changes. This involves:

  • Molecular simulations with AI-enhanced sampling

  • Trajectory clustering to identify representative structures

  • Diffusion-based AI models and active learning AutoML to generate statistically robust ensembles of protein conformations

• Binding pocket identification: AI-based pocket prediction modules discover orthosteric, allosteric, hidden, and cryptic binding pockets on the protein surface by integrating:

  • LLM-driven literature analysis

  • Structure-aware ensemble-based pocket detection

  • AI scoring and ranking of potential binding sites

These computational approaches complement experimental methods by revealing dynamic behaviors difficult to capture through traditional structural biology techniques.

What does research reveal about the evolutionary significance of MT-ND4L in Pipistrellus abramus populations?

Research on MT-ND4L in P. abramus has provided valuable insights into bat evolution and adaptation:

• Phylogeographic patterns: Mitochondrial DNA analysis, including MT-ND4L, has revealed two divergent geographical clades in P. abramus, indicating multiple glacial refugia in eastern Asia. The first clade is mainly confined to Hainan Island, while the second shows evidence of expansion across mainland China and the Zhoushan Archipelago .

• Population structure and isolation: Despite Hainan Island being repeatedly connected to mainland China during glacial periods, gene flow of mitochondrial genes between island and mainland populations has been restricted, suggesting adaptive divergence of mitochondrial genes including MT-ND4L .

• Selective pressures: While population-based analyses of some mitochondrial genes (like Cytb) show purifying selection, others (like ND5, which functions alongside ND4L in Complex I) demonstrate neutrality. Multiple nonsynonymous substitutions have been identified that were likely driven by positive selection .

This evolutionary pattern supports the view that molecular adaptation can occur at genes under strong purifying selection when nonsynonymous substitutions cause radical changes in amino acid physicochemical properties, potentially optimizing energy production in different environmental conditions .

How does P. abramus MT-ND4L contribute to understanding broader chiropteran evolutionary relationships?

MT-ND4L, along with other mitochondrial genes, has contributed significantly to resolving chiropteran phylogeny:

• Bat phylogenetic placement: Maximum likelihood analysis of complete mitochondrial genomes, including MT-ND4L sequences, supports a sister relationship between chiropterans (bats) and eulipotyphlans (moles and shrews), with this clade closely related to fereuungulates (Cetartiodactyla, Perissodactyla, and Carnivora) .

• Divergence timing: Using relaxed molecular clock analysis of mitochondrial protein sequences, including MT-ND4L, bats and eulipotyphlans were estimated to have diverged approximately 68 million years before present .

• Virus-host coevolution: The MT-ND4L gene has also helped trace the evolutionary history of P. abramus in relation to its viral pathogens. The Japanese pipistrelle bat has been identified as a host for several coronaviruses, including bat coronavirus HKU5 variants, providing insights into host-pathogen coevolution .

This mitochondrial evidence contributes to ongoing debates about chiropteran monophyly versus polyphyly and helps establish more accurate timelines for mammalian evolution.

What are common challenges in working with recombinant P. abramus MT-ND4L and how can they be addressed?

Researchers working with recombinant P. abramus MT-ND4L frequently encounter several technical challenges:

How can researchers distinguish between functional and non-functional recombinant P. abramus MT-ND4L preparations?

Distinguishing functional from non-functional recombinant preparations requires multiple complementary assays:

• Spectroscopic characterization: Functional MT-ND4L should demonstrate:

  • Characteristic UV-visible absorbance features when incorporated into Complex I

  • Proper secondary structure content as assessed by circular dichroism

  • Thermal stability profiles consistent with folded membrane proteins

• Activity assays: Several functional tests can verify activity:

  • NADH oxidation activity when incorporated into liposomes with other Complex I components

  • Sensitivity to specific inhibitors like NADH-OH at expected concentrations (Ki ~1 nM)

  • Proton translocation capacity when reconstituted into proteoliposomes

• Binding studies: Verify proper folding through:

  • Interaction with known Complex I assembly factors

  • Integration into partial Complex I assemblies

  • Proper membrane insertion demonstrated by protease protection assays

• Comparative analysis: Compare activity parameters with:

  • Wild-type MT-ND4L isolated from native mitochondria

  • Recombinant MT-ND4L from well-characterized model organisms

  • Published kinetic parameters for electron transfer reactions

A preparation yielding ≥90% purity by SDS-PAGE, with demonstrated NADH oxidation activity and expected inhibitor sensitivity profiles, can be considered functionally active and suitable for further experimentation .

What emerging methodologies hold promise for advancing understanding of P. abramus MT-ND4L?

Several cutting-edge approaches are poised to transform research on P. abramus MT-ND4L:

• Cryo-electron microscopy: High-resolution structural characterization of MT-ND4L within the context of the complete Complex I will reveal critical interactions and conformational states. Recent advances enabling resolution of <2Å for membrane protein complexes can now resolve individual side-chain orientations and bound water molecules .

• Native mass spectrometry: This technique can analyze intact membrane protein complexes, revealing subunit stoichiometry and interactions. Studies on bovine Complex I have already identified novel subunits using this approach and could similarly advance understanding of bat Complex I composition .

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This method can map dynamic regions and conformational changes during the catalytic cycle, providing insights into how MT-ND4L contributes to proton translocation .

• Gene editing in bat cell lines: The development of CRISPR-Cas9 systems optimized for bat cells would enable precise modification of MT-ND4L to study structure-function relationships in cellular contexts closer to the native environment.

• Single-molecule functional assays: Techniques like single-molecule FRET could track conformational dynamics of MT-ND4L during electron transport and proton pumping, revealing mechanistic details currently inaccessible through bulk measurements .

How might research on P. abramus MT-ND4L inform broader understanding of mitochondrial diseases and bioenergetics?

Research on P. abramus MT-ND4L has several promising applications for human health and bioenergetics:

• Comparative mitochondrial function: Bats have high metabolic rates yet exceptional longevity, suggesting their mitochondrial complexes may have evolved unique protective mechanisms against oxidative damage. Comparing P. abramus MT-ND4L structure and function with human homologs could reveal adaptations that enhance efficiency or reduce reactive oxygen species production .

• Therapeutic target identification: Complex I dysfunction is implicated in numerous human diseases, including neurodegenerative disorders. AI-based structural analysis of P. abramus MT-ND4L has identified potential binding pockets that could inform drug development targeting equivalent regions in human Complex I .

• Evolutionary medicine insights: The adaptive evolution observed in P. abramus MT-ND4L across different ecological contexts demonstrates how environmental pressures shape mitochondrial function. This evolutionary perspective could inform understanding of human mitochondrial haplogroups and their association with disease susceptibility in different populations .

• Bioenergetic engineering: Understanding the structure-function relationships in P. abramus MT-ND4L could inform bioengineering efforts to enhance mitochondrial efficiency in industrial applications or to create synthetic bioenergetic systems with improved properties.