Recombinant Pirellula staleyi ATP-dependent zinc metalloprotease FtsH (ftsH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will ship the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
ftsH; Psta_3565; ATP-dependent zinc metalloprotease FtsH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-700
Protein Length
full length protein
Species
Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) (Pirella staleyi)
Target Names
ftsH
Target Protein Sequence
MSSDNGSGRQGGDRGGSTGYNLLMYLGFGAIIATLVALYVLQMFQTSLDYTDLERLVAAS QYEKDESKLTAGSPGYIDVKVEARNTLRRMRVSNLRKVELGPTAVRGQIDLVELKPVGTS GDRWEPDSKTLRQNVEFRTNLSDKGSNRDDIETAIRNSNIPFRHADPPGPWEQHSQLIIG MLLAAMLIYIVVRRLSAAGSPMSFGRSRGKLYAQEELGITFNDVAGIDEAVEEVREVVDF LRSPEKYQKLGGRIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSLSGSDFVEMFVGVGA ARVRDMFQQAEAKAPCIIFIDELDALGKSRGAGIMGGHDEREQTLNALLVEMDGFGSNSG VIVMAATNRPETLDPALLRPGRFDRHVLVDRPDIKGREDILKVHVKNVKLDPTVDLHKVA AITPGFVGADLANLVNEAALLAARAEKTAVGMNEFNEGVERVTAGLEKKQRVMNEDEKLR VAYHESGHALVAYSLPNTDPVHKVSIIPRGLAALGYTMQRPEGDRFLMTQSELESRIQVL LAGTIAEEIIFTDISTGAQNDLERATDIARRMCMEFGMSRLGRVNYRESNRSAFLASGGS GEERVRSVSEQTLREIDQEVRRIIDESIEKVRHILDVRRGALVSLTNRLMEVESVDSDEL KRIIDETSPGPLVVPGTLPANTMRSTTEPVITAPATERSG
Uniprot No.

Target Background

Function

This recombinant Pirellula staleyi ATP-dependent zinc metalloprotease FtsH functions as a processive, ATP-dependent enzyme that degrades both cytoplasmic and membrane proteins. It plays a crucial role in the quality control of integral membrane proteins.

Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein; Cytoplasmic side.

Q&A

What is the structural composition of Recombinant Pirellula staleyi ATP-dependent zinc metalloprotease FtsH?

Recombinant Pirellula staleyi ATP-dependent zinc metalloprotease FtsH is a full-length protein consisting of 700 amino acids (1-700aa) that functions as a membrane-bound ATPase . The protein contains an amino acid sequence beginning with MSSDNGSGRQGGDRGGSTGY and ending with TEPARSVITAPATERSG . When expressed recombinantly, it is typically fused to an N-terminal His tag to facilitate purification .

The protein contains several functional domains, including:

  • ATPase domain with the characteristic Walker motifs

  • Zinc metalloprotease catalytic domain

  • Transmembrane regions that anchor the protein to the membrane

The structural integrity of FtsH is crucial for its function in protein quality control and membrane protein biogenesis processes .

How does FtsH recognize and select its protein substrates?

FtsH employs a unique substrate recognition mechanism that differs from other AAA+ proteases. While many proteases require unstructured termini for substrate engagement, FtsH can recognize internal sequences within partially unfolded proteins .

Research with model substrates like dihydrofolate reductase (DHFR) demonstrates that FtsH can degrade proteins through non-canonical mechanisms. While earlier studies suggested FtsH required degron tags (like ssrA) and long unstructured regions for degradation, recent findings reveal that FtsH can degrade untagged proteins by recognizing partially unfolded states .

Experimental evidence supporting this includes:

  • FtsH degrades DHFR variants with tails of different lengths (60, 40, 19, and 11 residues) and even untagged DHFR at similar rates

  • Domain fusion experiments with HaloTag domains at both termini of DHFR (Halo-DHFR-Halo) show that FtsH can engage and degrade proteins without access to terminal residues, confirming the importance of internal recognition sequences

This non-canonical recognition mechanism represents an important adaptation in FtsH's role in protein quality control, allowing it to target proteins based on partial unfolding rather than strict terminal sequence requirements.

What are the recommended storage and reconstitution protocols for recombinant FtsH?

For optimal stability and activity of recombinant Pirellula staleyi FtsH, the following storage and reconstitution protocols are recommended:

Storage conditions:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to prevent repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

  • Aliquot for long-term storage at -20°C/-80°C

Storage buffer composition:

  • Tris/PBS-based buffer

  • 6% Trehalose

  • pH 8.0

Following these protocols is critical for maintaining protein stability and enzymatic activity, particularly since repeated freeze-thaw cycles significantly reduce protein integrity and function.

What experimental techniques are most effective for studying FtsH activity?

Several experimental approaches have proven effective for studying FtsH activity in research settings:

Protein degradation assays:

  • SDS-PAGE analysis with time-course sampling to monitor substrate degradation

  • Fluorescent labeling of substrates (e.g., labeling cysteine residues with fluorophores) for real-time monitoring of degradation kinetics

  • Western blotting for detection of partial degradation products

Domain fusion experiments:

  • Creation of fusion proteins (e.g., Halo-DHFR-Halo) to investigate substrate engagement mechanisms

  • Fluorescent tagging with tetramethylrhodamine (TMR) for visualization of degradation products

Mutagenesis approaches:

  • Site-directed mutagenesis to identify critical residues in the ATPase or protease domains

  • Creation of chimeric proteins to study domain-specific functions

In vivo studies:

  • Temperature-sensitive mutants (e.g., ftsH1) to study phenotypic effects

  • Controlled expression systems using inducible promoters (e.g., lac promoter-controlled FtsH expression) to study cellular effects of FtsH depletion

These methodologies collectively provide complementary approaches to investigate different aspects of FtsH function, from molecular mechanisms to cellular roles.

How does FtsH's mechanism of action differ from other AAA+ proteases in protein degradation?

FtsH exhibits several distinct features that differentiate it from other AAA+ proteases in the bacterial proteome:

Unique substrate engagement:
Unlike most AAA+ proteases that require unstructured N or C-terminal tails for initial substrate engagement, FtsH can recognize and engage internal sequences within partially unfolded proteins . This allows FtsH to target substrates lacking the canonical degron tags or unstructured termini.

Membrane association:
While many AAA+ proteases are soluble, FtsH is membrane-bound, with its axial channel facing the membrane . This spatial constraint influences substrate selection and degradation mechanisms.

Comparison of substrate recognition between FtsH and other AAA+ proteases:

FeatureFtsHOther AAA+ Proteases (e.g., ClpXP, Lon)
Initial engagementCan recognize internal sequences in partially unfolded proteinsTypically require unstructured N or C-termini
Degron requirementCan degrade proteins without canonical degronsOften rely on specific degron tags (e.g., ssrA)
LocalizationMembrane-boundPrimarily cytosolic
Unfolding powerLower unfolding capacityHigher unfolding capacity
ATP consumptionHigher ATP consumption per substrateMore efficient ATP utilization

Research with model substrates demonstrates that FtsH can degrade DHFR with various linker lengths and even without tags, indicating recognition of the DHFR protein itself rather than relying exclusively on degron tags . This non-canonical recognition mechanism represents an important adaptation in protein quality control systems.

What is the role of FtsH in membrane protein biogenesis and how can this be experimentally demonstrated?

FtsH plays a critical role in membrane protein biogenesis by participating in the quality control of membrane proteins and facilitating their proper assembly:

Key functions in membrane protein biogenesis:

  • Facilitates "stop transfer" anchoring of transmembrane segments during protein insertion

  • Contributes to the proper assembly of proteins into and through the membrane

  • Balances the efficiency of protein translocation across membranes

Experimental evidence:
Research using SecY-PhoA fusion proteins demonstrated that mutations in the ftsH gene (std101 mutation) allowed significant export of normally anchored protein segments across the membrane . Similarly, the temperature-sensitive ftsH1 mutation produced a similar phenotype, confirming FtsH's role in membrane protein insertion .

Experimental approaches to study FtsH's role in membrane biogenesis:

  • Fusion protein assays:

    • Construct SecY-PhoA fusion proteins where alkaline phosphatase (PhoA) is attached to transmembrane segments

    • Measure PhoA activity as an indicator of translocation efficiency

    • Compare wild-type and FtsH-deficient cells to quantify differences in membrane insertion

  • Controlled expression systems:

    • Develop lac promoter-controlled FtsH expression systems

    • Monitor membrane protein assembly during FtsH depletion

    • Observe effects on specific membrane proteins (e.g., OmpA, β-lactamase)

  • Phenotypic analysis:

    • Characterize the "stop-transfer defect" (Std) phenotype

    • Measure export of normally anchored protein segments and translocation of normally exported proteins

    • Quantify membrane protein composition changes

The combined results of these approaches indicate that FtsH functions as a crucial quality control component that ensures proper membrane protein topology by balancing the efficiency of stop-transfer and translocation processes.

How can researchers troubleshoot common issues with recombinant FtsH activity in experimental systems?

Researchers working with recombinant Pirellula staleyi FtsH may encounter several challenges affecting protein activity. The following troubleshooting guide addresses common issues:

Problem: Low or absent enzymatic activity

Potential CauseTroubleshooting ApproachSolution
Protein misfoldingAnalyze protein by native PAGE or size exclusion chromatographyOptimize expression conditions; reduce expression temperature; use chaperone co-expression systems
Metal ion deficiencyTest activity with varying zinc concentrationsSupplement reaction buffer with ZnCl₂ (typically 0.1-1 mM)
Improper buffer conditionsTest activity across pH range 6.5-8.5Adjust buffer composition and pH; ensure proper ionic strength
ATP degradationCheck ATP qualityPrepare fresh ATP solutions; consider using non-hydrolyzable ATP analogs as controls

Problem: Poor substrate degradation

Potential CauseTroubleshooting ApproachSolution
Substrate stabilityTest substrate in unfolding conditionsInclude mild denaturants to create partially unfolded substrate states
Incorrect substrate:enzyme ratioTitrate enzyme:substrate ratiosOptimize ratios; typical starting point is 1:10 to 1:100 enzyme:substrate
Inhibitory contaminantsPurify enzyme further; test for inhibitionAdditional purification steps; dialysis against fresh buffer
Missing cofactorsSupplement reaction with potential cofactorsAdd ATP, Mg²⁺, and Zn²⁺ at optimal concentrations

Problem: Protein aggregation during storage or assays

Potential CauseTroubleshooting ApproachSolution
Freeze-thaw damageCheck protein after freeze-thaw cyclesAvoid repeated freeze-thaw; store in single-use aliquots with 50% glycerol
Improper storage bufferTest different buffer compositionsUse Tris/PBS-based buffer with 6% Trehalose at pH 8.0
High protein concentrationDilute protein and test activityWork at lower concentrations (0.1-1.0 mg/mL); concentrate only before use
Detergent issuesTry different detergent types and concentrationsOptimize detergent for membrane protein solubilization while maintaining activity

These troubleshooting approaches are based on general principles for working with membrane-associated proteases and the specific recommendations for Pirellula staleyi FtsH .

What are the critical differences between FtsH from Pirellula staleyi and FtsH homologs from other bacterial species?

FtsH proteases are widely distributed across bacteria, but exhibit species-specific variations that affect their function and regulation. The Pirellula staleyi FtsH has several distinctive features compared to homologs from other bacterial species:

Structural and sequence comparisons:
Pirellula staleyi FtsH consists of 700 amino acids with specific sequence features that differentiate it from other FtsH homologs . The complete amino acid sequence (as shown in search result ) provides the basis for comparative analyses.

Taxonomic context:
Pirellula staleyi belongs to the phylum Planctomycetes, a unique bacterial group with distinctive cell biology features . This taxonomic position is important when considering the evolutionary diversification of FtsH functions.

Comparative analysis of FtsH across bacterial species:

FeaturePirellula staleyi FtsHE. coli FtsHOther Bacterial FtsH Homologs
Sequence length700 amino acids Typically 600-650 amino acidsVariable (550-700 amino acids)
Substrate specificityPartially characterizedWell-characterized (e.g., σ32, λcII, SecY)Species-dependent
Cellular abundanceUnknown~100 molecules per cellVariable across species
Membrane associationPresumed single transmembrane domainTwo transmembrane domainsVaries (1-2 domains typical)
Regulatory partnersNot characterizedHflKC complexSpecies-specific partners

Methodological approaches to study species differences:

  • Heterologous expression studies:

    • Express FtsH from different species in a common host

    • Compare substrate degradation profiles

    • Identify species-specific regulators

  • Chimeric protein analysis:

    • Create domain swaps between Pirellula staleyi FtsH and other homologs

    • Identify domains responsible for differential activity

    • Map species-specific functions to structural elements

  • Phylogenetic analysis:

    • Construct phylogenetic trees of FtsH sequences

    • Correlate sequence variations with known functional differences

    • Identify conserved vs. variable regions

Understanding these species-specific differences provides insights into the evolutionary adaptation of FtsH to different cellular environments and may reveal novel mechanisms of protein quality control.

How can researchers optimize expression and purification of Recombinant Pirellula staleyi FtsH for structural studies?

Structural characterization of membrane proteins like FtsH presents significant challenges. The following methodological approaches can optimize expression and purification of Pirellula staleyi FtsH for structural studies:

Expression optimization strategies:

  • Expression system selection:

    • E. coli is a proven system for Pirellula staleyi FtsH expression

    • Consider specialized E. coli strains (C41/C43, BL21-AI) designed for membrane protein expression

    • For challenging constructs, evaluate insect or mammalian expression systems

  • Construct design considerations:

    • Include N-terminal His-tag for affinity purification

    • Test various tag positions (N-terminal vs. C-terminal)

    • Evaluate tag types (His, Strep, MBP) for improved solubility and crystallization

    • Create truncation constructs isolating specific domains for domain-specific studies

  • Expression condition optimization:

    ParameterVariables to TestMonitoring Method
    Temperature18°C, 25°C, 30°C, 37°CSDS-PAGE, Western blot
    Induction timingOD₆₀₀ = 0.4-1.0Growth curve analysis
    Inducer concentration0.1-1.0 mM IPTGExpression yield
    Media compositionLB, TB, auto-inductionBiomass and protein yield
    AdditivesZinc supplementation, osmolytesProtein folding quality

Purification protocol optimization:

  • Membrane extraction:

    • Test detergent panel (DDM, LMNG, LDAO, etc.)

    • Optimize detergent concentration and extraction time

    • Validate protein integrity after extraction

  • Chromatography strategy:

    • Primary: Immobilized metal affinity chromatography (IMAC)

    • Secondary: Size exclusion chromatography

    • Optional: Ion exchange chromatography for higher purity

  • Buffer optimization:

    • Final buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • Storage recommendations: 50% glycerol for long-term stability

    • Evaluate stabilizing additives: specific lipids, ATP/ADP, zinc

Quality control assessments:

  • Homogeneity analysis:

    • Size exclusion chromatography

    • Dynamic light scattering

    • Native PAGE

  • Functional verification:

    • ATPase activity assays

    • Proteolytic activity using model substrates

    • Thermal stability assays (Thermofluor)

Implementation of these methodologies significantly increases the likelihood of obtaining protein samples suitable for structural studies using X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy.

What experimental systems can be used to study FtsH-dependent degradation in a controlled environment?

Researchers have developed several experimental systems to investigate FtsH-dependent degradation in controlled settings. These systems provide valuable insights into FtsH's mechanism and substrate specificity:

In vitro reconstitution systems:

  • Purified component systems:

    • Utilize purified recombinant Pirellula staleyi FtsH protein

    • Include ATP, Mg²⁺, and Zn²⁺ as essential cofactors

    • Monitor degradation of model substrates like DHFR

    • Advantages: Precise control over reaction conditions; ability to test specific mechanisms

  • Membrane reconstitution approaches:

    • Incorporate purified FtsH into liposomes or nanodiscs

    • More closely mimics native membrane environment

    • Allows investigation of membrane-dependent activities

    • Advantages: Better represents native environment; preserves membrane protein interactions

Model substrate systems:

SubstrateAdvantagesMonitoring MethodsKey Findings
DHFR-ssrA with varying linker lengthsStable, well-characterized protein; modifiable with different tagsSDS-PAGE, fluorescence labelingFtsH can degrade DHFR with various linker lengths and even untagged DHFR
Halo-DHFR-HaloTests importance of terminal accessFluorescent labeling with TMRFtsH can engage internal sequences without terminal access
SecY-PhoA fusionMonitors membrane protein insertionAlkaline phosphatase activityFtsH influences "stop transfer" efficiency in membrane proteins

Controlled cellular systems:

  • Inducible FtsH expression:

    • lac promoter-controlled FtsH expression allows titration of FtsH levels

    • Monitor effects on specific substrates during FtsH depletion

    • Advantages: Studies FtsH function in native cellular context

  • Temperature-sensitive mutants:

    • ftsH1 and other conditional mutants allow temporal control of FtsH activity

    • Shift experiments reveal immediate vs. downstream effects

    • Advantages: Avoids complications from complete FtsH absence

These experimental systems collectively provide complementary approaches to investigate different aspects of FtsH function, from biochemical mechanisms to cellular roles, enabling researchers to build a comprehensive understanding of FtsH-dependent degradation processes.

How can researchers accurately determine the kinetic parameters of FtsH-mediated protein degradation?

Accurate determination of kinetic parameters for FtsH-mediated protein degradation requires careful experimental design and appropriate analytical methods. The following methodological approaches are recommended:

Substrate preparation and labeling:

  • Fluorescent labeling strategies:

    • Label solvent-exposed cysteine residues with fluorophores for real-time detection

    • Ensure labeling doesn't interfere with substrate recognition

    • Validate that labeled substrates behave similarly to unlabeled versions

  • Radioisotope labeling:

    • ³⁵S-methionine labeling for highly sensitive detection

    • Particularly useful for complex mixture analysis

    • Requires additional safety precautions

Experimental setup for kinetic measurements:

  • Initial velocity determinations:

    • Use substrate concentrations spanning 0.2-5× Kₘ values

    • Ensure < 10% substrate consumption for initial velocity conditions

    • Include time points that establish linear reaction rates

  • Steady-state kinetic measurements:

    ParameterExperimental ApproachData Analysis Method
    Kₘ, VₘₐₓVary substrate concentration (0.2-5× Kₘ)Michaelis-Menten, Lineweaver-Burk, or Eadie-Hofstee plots
    kcatDetermine enzyme concentration preciselyCalculate from Vₘₐₓ = kcat × [Enzyme]
    Specificity constant (kcat/Kₘ)Compare across substrate variantsDerive from individual kcat and Kₘ values
  • Competition assays:

    • Compare degradation rates of different substrates in the same reaction

    • Useful for determining relative preferences for different substrates

    • Can reveal substrate hierarchies

Advanced kinetic analyses:

  • Pre-steady-state kinetics:

    • Employ rapid mixing techniques (stopped-flow)

    • Identify rate-limiting steps in the degradation process

    • Separate binding, unfolding, and proteolytic events

  • Single-molecule approaches:

    • Use TIRF microscopy to observe individual degradation events

    • Capture heterogeneity in degradation kinetics

    • Reveal mechanistic details masked in bulk measurements

Data analysis and interpretation:

  • Model fitting considerations:

    • Test multiple models (competitive, non-competitive, uncompetitive inhibition)

    • Apply statistical criteria for model selection (AIC, BIC)

    • Consider cooperativity and allosteric effects in data interpretation

  • Controls for FtsH-specific degradation:

    • Include ATP-depleted conditions as negative controls

    • Test ATPase-deficient FtsH mutants

    • Verify ATP dependence of observed degradation

By implementing these methodological approaches, researchers can obtain reliable kinetic parameters that provide insights into FtsH's substrate preference, catalytic efficiency, and mechanistic details of protein degradation.

What techniques are most effective for studying the interaction between FtsH and membrane systems?

Understanding FtsH interactions with membrane systems is crucial given its membrane-anchored nature and role in membrane protein biogenesis . The following techniques provide complementary approaches for studying these interactions:

Membrane reconstitution approaches:

  • Proteoliposome reconstitution:

    • Incorporate purified FtsH into defined lipid compositions

    • Test effects of lipid composition on activity

    • Advantages: Controlled membrane environment; mimics natural bilayer

  • Nanodisc technology:

    • Reconstitute FtsH in nanodiscs with defined lipid composition

    • Compatible with multiple biophysical techniques

    • Advantages: Soluble membrane protein samples with accessible surfaces

  • Supported lipid bilayers:

    • Create planar membrane systems with incorporated FtsH

    • Compatible with surface-sensitive techniques

    • Advantages: Allows lateral mobility studies; amenable to microscopy

Biophysical characterization methods:

TechniqueInformation ProvidedAdvantagesLimitations
Fluorescence Resonance Energy Transfer (FRET)Protein-lipid proximity; conformational changesHigh sensitivity; real-time measurementsRequires fluorescent labeling
Atomic Force Microscopy (AFM)Topography; mechanical propertiesDirect visualization; force measurementsSample preparation challenges
Surface Plasmon Resonance (SPR)Binding kinetics and affinitiesLabel-free; real-time association/dissociationRequires surface immobilization
Neutron ReflectometryDepth profile of proteins in membranesDistinguishes protein from lipid componentsLimited availability; complex analysis

Functional assays in membrane contexts:

  • Activity assays with membrane substrates:

    • Compare degradation of soluble vs. membrane-embedded substrates

    • Test accessibility of transmembrane domains

    • Correlate degradation efficiency with membrane localization

  • Transmembrane segment translocation assays:

    • Utilize SecY-PhoA fusion proteins to monitor translocation

    • Quantify PhoA activity as measure of translocation efficiency

    • Compare wild-type and FtsH-deficient conditions

  • Membrane protein topology analysis:

    • Employ protease protection assays

    • Use site-specific labeling to determine transmembrane orientation

    • Monitor topology changes during FtsH-mediated degradation

Advanced microscopy techniques:

  • Single-particle cryo-electron microscopy:

    • Visualize FtsH structure in membrane environments

    • Capture different conformational states

    • Advantages: Near-atomic resolution possible; minimal sample perturbation

  • Super-resolution microscopy:

    • Track FtsH localization and dynamics in cellular membranes

    • Correlate with substrate localization

    • Advantages: Visualization in native cellular context

These methodological approaches collectively provide researchers with tools to investigate the complex interplay between FtsH activity and membrane systems, from molecular interactions to functional consequences in cellular contexts.

How can researchers develop effective assays for identifying novel FtsH substrates in Pirellula staleyi?

Identifying novel FtsH substrates in Pirellula staleyi requires systematic approaches that combine proteomics, genetics, and biochemical validation. The following methodological framework outlines effective strategies:

Global proteomic approaches:

  • Comparative proteomics:

    • Compare protein abundance in wild-type vs. FtsH-depleted conditions

    • Identify proteins that accumulate when FtsH is absent

    • Use stable isotope labeling (SILAC) for quantitative comparison

    • Advantages: Unbiased, genome-wide survey

  • Pulse-chase proteomics:

    • Label newly synthesized proteins and track their turnover

    • Compare degradation rates in presence/absence of functional FtsH

    • Identify proteins with FtsH-dependent stability

    • Advantages: Focuses specifically on protein turnover

Substrate trapping strategies:

  • Catalytic site mutants:

    • Generate proteolytically inactive FtsH mutants that bind but don't degrade

    • Isolate substrate-enzyme complexes

    • Identify trapped proteins by mass spectrometry

    • Advantages: Enriches for direct substrates

  • Crosslinking approaches:

    Crosslinking MethodMechanismAdvantagesLimitations
    Photo-crosslinkingUV-activated crosslinker incorporationSite-specific; controlled activationRequires genetic code expansion
    Chemical crosslinkingBifunctional reagents target specific amino acidsSimple application; various specificitiesLess specific; background reactions
    APEX2 proximity labelingPeroxidase-catalyzed biotinylation of nearby proteinsMaps interaction neighborhood; works in living cellsIncludes both substrates and other interactors

Validation of candidate substrates:

  • In vitro degradation assays:

    • Express and purify candidate substrates

    • Test direct degradation by purified FtsH

    • Determine kinetic parameters for degradation

    • Advantages: Confirms direct FtsH-dependent degradation

  • In vivo stability measurements:

    • Monitor candidate protein levels after FtsH depletion

    • Use translation inhibition (chloramphenicol) to measure turnover

    • Employ fluorescent protein fusions for real-time monitoring

    • Advantages: Confirms physiological relevance

  • Sequence motif analysis:

    • Analyze identified substrates for common sequence features

    • Use machine learning to predict additional substrates

    • Test predictions experimentally

    • Advantages: May reveal recognition principles

Spatial context analysis:

  • Membrane fractionation:

    • Separate membrane compartments

    • Identify co-localized potential substrates

    • Analyze spatial proximity to FtsH

    • Advantages: Focuses on physiologically relevant substrates

  • Co-evolution analysis:

    • Compare evolutionary conservation patterns between FtsH and potential substrates

    • Identify proteins with correlated presence/absence or mutation patterns

    • Advantages: Suggests functionally linked proteins

By implementing these complementary approaches, researchers can develop a comprehensive understanding of the FtsH substrate landscape in Pirellula staleyi, revealing both the principles of substrate selection and the functional importance of FtsH-mediated degradation in cellular physiology.

What are the current gaps in knowledge regarding Pirellula staleyi FtsH and future research directions?

Despite considerable advances in understanding FtsH proteases, several significant knowledge gaps remain specific to Pirellula staleyi FtsH that represent important opportunities for future research:

Structural characterization gaps:

  • The three-dimensional structure of Pirellula staleyi FtsH remains undetermined

  • The precise arrangement of functional domains and their coordination remains hypothetical

  • The membrane topology and oligomeric state specific to this homolog need confirmation

Substrate specificity questions:

  • The natural substrate profile in Pirellula staleyi is largely unknown

  • The determinants of substrate recognition remain poorly characterized

  • How substrate recognition differs from other bacterial FtsH homologs is unclear

Physiological role uncertainties:

  • The essential cellular functions of FtsH in Planctomycetes require investigation

  • The relationship between FtsH and the unique cell biology of Planctomycetes needs exploration

  • The role of FtsH in Pirellula staleyi stress responses remains uncharacterized

Future research directions table:

Research AreaKey QuestionsMethodological Approaches
Structural biologyWhat is the atomic structure of Pirellula staleyi FtsH?Cryo-EM; X-ray crystallography; integrative structural modeling
Substrate identificationWhat are the natural substrates in Pirellula staleyi?Comparative proteomics; substrate trapping; degradome analysis
Membrane interactionsHow does FtsH interact with Planctomycetes membranes?Membrane reconstitution; lipid interaction studies; topology mapping
Physiological rolesWhat are the essential functions in Pirellula staleyi?Genetic manipulation; phenotypic analysis; stress response studies
Evolutionary analysisHow has FtsH evolved in the Planctomycetes lineage?Phylogenetic analysis; ancestral sequence reconstruction; comparative genomics

Technical challenges to address:

  • Development of genetic manipulation systems for Pirellula staleyi

  • Optimization of expression and purification for structural studies

  • Creation of specific antibodies for immunological studies

  • Establishment of in vivo imaging techniques for this bacterial species

Addressing these knowledge gaps would significantly advance our understanding of FtsH biology in Pirellula staleyi and potentially reveal unique adaptations in this fascinating bacterial lineage. The evolutionary position of Planctomycetes makes this FtsH homolog particularly interesting for comparative studies across bacterial diversity.

How can researchers integrate knowledge about Pirellula staleyi FtsH with broader understanding of proteostasis systems?

Integrating knowledge about Pirellula staleyi FtsH into the broader context of proteostasis systems provides valuable comparative insights and reveals evolutionary principles. Several methodological approaches facilitate this integration:

Comparative analysis frameworks:

  • Phylogenetic profiling:

    • Map FtsH presence/absence across bacterial phyla

    • Correlate with proteostasis components and cellular features

    • Identify co-evolutionary patterns suggesting functional relationships

    • Particular focus on comparing Planctomycetes with other bacterial lineages

  • Domain architecture comparison:

    • Analyze domain organization across FtsH homologs

    • Identify lineage-specific adaptations

    • Correlate structural features with functional differences

Systems biology approaches:

  • Network integration:

    • Position FtsH within protein quality control networks

    • Map interactions with other proteostasis components

    • Compare network topologies across bacterial lineages

    Proteostasis ComponentRelationship to FtsHIntegration Method
    Chaperone systemsPotential substrate targetingInteractome mapping; genetic interaction screens
    Other AAA+ proteasesFunctional complementationSubstrate overlap analysis; depletion phenotypes
    Membrane protein insertion machineryCollaborative functionCo-expression analysis; physical interaction mapping
  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Create comprehensive models of FtsH's role in cellular homeostasis

    • Compare regulatory networks across bacterial species

Evolutionary context analysis:

  • Ancestral state reconstruction:

    • Infer ancestral FtsH sequences and functions

    • Track functional shifts across bacterial evolution

    • Identify conserved vs. lineage-specific features

  • Horizontal gene transfer assessment:

    • Evaluate evidence for HGT in FtsH evolution

    • Identify potential adaptive advantages driving selection

    • Compare with vertical inheritance patterns

Functional conservation testing:

  • Cross-species complementation:

    • Test whether Pirellula staleyi FtsH can complement E. coli ftsH mutants

    • Identify functional domains required for complementation

    • Map species-specific functions to structural elements

  • Chimeric protein analysis:

    • Create domain swaps between FtsH homologs

    • Test substrate specificity determinants

    • Identify the molecular basis for functional differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.