Recombinant Pirital virus Pre-glycoprotein polyprotein GP complex (GPC)

Shipped with Ice Packs
In Stock

Description

Composition and Synthesis

GPC is initially synthesized as a precursor polypeptide, which then undergoes two proteolytic cleavages to form the mature envelope glycoprotein complex . The nascent polypeptide is directed to the endoplasmic reticulum via its signal peptide and cleaved from the G1-G2 precursor by cellular signal peptidase . The signal peptide in GPC is stable and forms an essential element of the mature complex . This stable signal peptide (SSP) comprises 58 amino acids, is myristoylated, and spans the membrane twice, with both the N and C termini located in the cytosol . The complex consists of the stable signal peptide (SSP), the receptor-binding subunit GP1, and the transmembrane subunit GP2 .

Role in Viral Entry and Virulence

The GPC plays an essential role in mediating viral entry and contributes to viral virulence in vivo . Studies using the Pirital virus (PICV) reverse genetics system have shown that multiple SSP conserved residues are essential for viral infection of cell culture and/or guinea pigs by participating in the membrane fusion reaction .

Functional Analysis of GP2 Cytoplasmic Tail (CT)

The GP2 cytoplasmic tail (CT) is relatively conserved among arenaviruses and interacts with the SSP to regulate GP processing and membrane fusion . Research has characterized the functional roles of conserved residues within the GP2 CT in GP processing, trafficking, assembly, and fusion, as well as in viral replication, using a Pichinde virus (PICV) GP expression vector and a PICV reverse genetics system .

Alanine substitutions at conserved residues (except for P478A and K505A R508A) abolished GP processing and membrane fusion in plasmid-transfected cells . Six invariant H and C residues and W503 are essential for viral replication, as evidenced by the fact that their mutant viruses could not be rescued .

GP Processing and Membrane Fusion

Mutations such as P480A and R482A, which show defective GP processing and membrane fusogenic activity similar to those of other nonviable mutants in GP plasmid-transfected cells, can be efficiently rescued, and these two mutations do not negatively impact viral replication in cell cultures . Full-genome sequencing analysis of the recombinant P480A and R482A viruses confirmed that they do not carry any other (compensatory) mutations .

Antiviral Strategies

Targeting the proteolytic processing of the viral glycoprotein precursor is a potential antiviral strategy against arenaviruses . Processing of the GP precursor (GPC) by the cellular proprotein convertase site 1 protease (S1P) is crucial for cell-to-cell propagation of infection and production of infectious virus .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
276-510
Protein Length
Full Length of Mature Protein
Species
Pirital mammarenavirus (isolate Rat/Venezuela/VAV-488/1995) (PIRV)
Target Names
GPC
Target Protein Sequence
GFFTWDISDSSGQHVPGGYCLEQWAIVWAGIKCFDNSVMAKCNKDHNEEFCDTMRLFDFN QNAIKTLQLNVENSLNLMKKSINGLISDSLVIRNSLKQLAKIPYCNYTKFWYVNDTITGK HSLPQCWLVSNGSYLNETHFKNEWLWESQKLYNDMLLKEYEERQGNTPLALADLCFWSLV FFTTTVFFQLIGIPTHRHLIGEGCPKPHRLTSNSLCSCGFYKIPKKPFRWVRKGK
Uniprot No.

Target Background

Function
The Recombinant Pirital virus Pre-glycoprotein polyprotein GP complex (GPC) is a class I viral fusion protein that mediates fusion between viral and host endosomal membranes, delivering the nucleocapsid into the cytoplasm. This fusion is triggered by irreversible conformational changes induced by endosomal acidification. The stable signal peptide (SSP) is cleaved, functioning as a signal peptide while remaining part of the GP complex. The SSP is crucial for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface, infectious virion formation, and acid pH-dependent glycoprotein-mediated cell fusion. The GPC also interacts with the host receptor.
Database Links

KEGG: vg:2845916

Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Pirital virus GPC and how does it compare to other arenavirus glycoproteins?

Pirital virus, belonging to the Arenaviridae family, expresses a single glycoprotein complex (GPC) on its viral surface that mediates host cell entry. Like other arenaviruses, Pirital virus GPC is initially synthesized as a precursor polyprotein that undergoes proteolytic processing to yield functional components. The mature GPC consists of three main components: a stable signal peptide (SSP), a receptor-binding subunit termed GP1, and a fusion-mediating transmembrane subunit termed GP2 .

The GPC forms trimers on the viral surface, with each protomer containing these three components. The trimeric arrangement is crucial for proper function, as many neutralizing antibody epitopes span multiple protomers . Crystal structure analysis of related arenaviruses like LCMV has revealed that the prefusion GP1-GP2 complex adopts a metastable conformation that undergoes significant conformational changes during the fusion process .

Based on structural studies of other arenaviruses, we can predict that Pirital virus GPC likely contains similar domains, including receptor-binding regions in GP1 and fusion peptides in GP2, though specific amino acid differences would determine its unique receptor preference and antigenic properties.

What is the role of cellular proteases in Pirital virus GPC processing and how can this be targeted for antiviral development?

Arenavirus GPC processing by cellular proteases represents a critical step in the viral life cycle. For most arenaviruses, including likely Pirital virus, the cellular proprotein convertase site 1 protease (S1P), also known as subtilisin-kexin-isozyme 1 (SKI-1), cleaves the GPC precursor to yield the peripheral GP1 and the transmembrane GP2 subunits . This processing is essential for producing infectious viral particles and cell-to-cell propagation.

Research with prototypic arenaviruses like LCMV has demonstrated that targeting S1P-mediated GPC processing with peptide-based inhibitors such as decanoyl-RRLL-chloromethylketone (dec-RRLL-CMK) can effectively block viral spread and virus production . Methodologically, researchers can assess the antiviral activity of S1P inhibitors against Pirital virus by:

  • Treating infected cells with the inhibitor and measuring viral titers

  • Monitoring GPC processing through western blot analysis

  • Combining the S1P inhibitor with other antivirals (like ribavirin) to assess additive effects

  • Evaluating the emergence of drug-resistant variants through long-term cultures

Importantly, studies with LCMV have shown that viral escape from S1P inhibition is unlikely, as persistent infection in S1P-deficient cells did not lead to the emergence of S1P-independent escape variants . This suggests that targeting GPC processing through S1P inhibition could be a promising approach for developing antivirals against Pirital virus with a high genetic barrier to resistance.

How do pH-dependent conformational changes in Pirital virus GPC facilitate membrane fusion?

Like other arenaviruses, Pirital virus GPC likely undergoes pH-dependent conformational changes that drive membrane fusion during viral entry. The hydrophobic regions of the GP2 subunit are particularly critical for this pH-dependent fusion process .

When the virus enters the endosome and encounters acidic pH, the metastable prefusion conformation of GPC undergoes dramatic structural rearrangements. These changes expose the fusion peptide of GP2, which inserts into the host cell membrane. Subsequently, GP2 folds back on itself to form a six-helix bundle structure, bringing the viral and cellular membranes into close proximity for fusion.

To study these conformational changes methodologically:

  • Researchers can use recombinant GPC proteins and monitor structural changes using circular dichroism spectroscopy at varying pH levels

  • Fluorescence-based fusion assays with labeled liposomes can quantify the fusion activity at different pH values

  • Mutagenesis of key residues in the fusion peptide and heptad repeat regions can identify critical amino acids for the fusion process

  • Cryo-electron microscopy can capture intermediate conformations during the fusion process

Understanding these pH-dependent changes is crucial for designing fusion inhibitors that could lock GPC in its prefusion state and prevent viral entry.

What are the optimal expression systems for producing recombinant Pirital virus GPC for structural studies?

For structural studies of arenavirus GPCs, several expression systems have been successfully employed, with mammalian cell expression generally yielding the most native-like glycoproteins. Based on studies with other arenaviruses, the following methodological approaches are recommended for Pirital virus GPC:

Mammalian Cell Expression:

  • HEK293T or ExpiCHO cells typically provide proper folding and glycosylation

  • Codon-optimization of the GPC sequence enhances expression levels

  • Addition of a C-terminal affinity tag (His6 or Fc) facilitates purification

  • Co-expression with furin can enhance processing if using a furin-cleavable construct

Stabilization Strategies:
To improve expression and stability of the prefusion conformation:

  • Introduction of proline mutations at position 328 (based on LASV studies) can stabilize the prefusion state

  • Appending a trimerization domain (T4 fibritin foldon or GCN4) helps maintain the native trimeric structure

  • Strategic disulfide bonds can be engineered to lock the protein in its prefusion conformation

Using these approaches, researchers have successfully expressed and purified prefusion-stabilized GPC trimers like the GPCv2 construct for LASV, which retained important conformational epitopes and elicited stronger neutralizing antibody responses compared to monomeric forms .

What purification challenges are specific to Pirital virus GPC and how can they be overcome?

Purification of recombinant arenavirus GPCs presents several challenges that would likely apply to Pirital virus GPC as well. These include:

  • Trimer Stability: Prefusion GPC trimers can dissociate into monomers during purification, resulting in the loss of critical neutralizing antibody epitopes . This can be addressed by:

    • Using mild detergents for membrane extraction

    • Incorporating stabilizing mutations or domains

    • Maintaining low temperatures throughout purification

    • Using size exclusion chromatography to isolate intact trimers

  • Extensive Glycosylation: Like other arenaviruses, Pirital virus GPC is likely covered by a dense glycan shield , which can interfere with crystallization. Approaches to manage this include:

    • Limited deglycosylation with endoglycosidases (EndoH or PNGase F)

    • Expression in GnTI-deficient cells for more homogeneous glycans

    • Site-directed mutagenesis to remove non-essential glycans

    • Using glycosylation inhibitors like kifunensine during expression

  • Metastability: The prefusion conformation is metastable and can spontaneously trigger to the postfusion state. To preserve the prefusion state:

    • Maintain pH above 7.0 throughout purification

    • Include stabilizing agents like arginine in buffers

    • Work quickly and at 4°C

    • Use antibodies that specifically recognize and lock the prefusion conformation

A typical purification workflow would include affinity chromatography (anti-His or Protein A for Fc-tagged constructs), followed by ion exchange chromatography and size exclusion chromatography to isolate properly folded, trimeric GPC.

How can X-ray crystallography be optimized for determining the structure of Pirital virus GPC?

X-ray crystallography has been successfully used to determine the structure of prefusion arenavirus GPCs, as demonstrated with LCMV GPC at 3.5Å resolution . For Pirital virus GPC, the following methodological approaches would be valuable:

Crystal Optimization Strategies:

  • Screening multiple truncation constructs to remove flexible regions

  • Testing various crystallization conditions, including those used for related arenaviruses (e.g., LCMV crystallized in I432 space group)

  • Incorporating Fab fragments from neutralizing antibodies to stabilize the structure and provide crystal contacts

  • Using surface entropy reduction mutations to promote crystal contacts

Based on the LCMV GPC crystallization parameters, researchers might start with conditions similar to those shown in the data collection table :

ParameterValue
Space groupI432
Cell dimensions (a, b, c in Å)262.33, 262.33, 262.33
Cell angles (α, β, γ in °)90, 90, 90
Resolution (Å)3.5

Additionally, both room temperature and frozen data collection strategies can be employed, as they have been successful for related arenaviruses . The use of heavy atom derivatives (like TaBr) may facilitate phase determination through isomorphous replacement or anomalous dispersion methods.

What are the advanced techniques for studying the conformational dynamics of Pirital virus GPC during the fusion process?

Understanding the conformational changes of GPC during the fusion process requires techniques that can capture dynamic states. For Pirital virus GPC research, the following methodological approaches would be valuable:

  • Cryo-Electron Microscopy (cryo-EM):

    • Single-particle cryo-EM can capture different conformational states of GPC

    • Time-resolved cryo-EM with pH jumps can visualize fusion intermediates

    • Sample preparation with detergent micelles or nanodiscs can mimic the membrane environment

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps regions of conformational flexibility and solvent accessibility

    • Can track changes in protein dynamics at different pH values

    • Identifies regions involved in conformational rearrangements

  • Single-Molecule Förster Resonance Energy Transfer (smFRET):

    • Strategic placement of fluorophores can monitor distances between domains

    • Real-time observation of conformational changes during fusion

    • Detects transient intermediates not captured by static structural methods

  • Molecular Dynamics Simulations:

    • Based on crystal structures, simulations can model conformational transitions

    • Predicts energy barriers between prefusion and postfusion states

    • Identifies druggable pockets that emerge during conformational changes

These techniques, used complementarily, can provide a comprehensive understanding of how Pirital virus GPC transitions from its prefusion to postfusion state, information critical for the design of fusion inhibitors and stabilized immunogens.

How can receptor binding properties of Pirital virus GPC be accurately determined?

Characterizing the receptor binding properties of Pirital virus GPC requires a combination of binding assays and functional studies. Based on methodologies employed for other arenaviruses, researchers can:

  • Identify Candidate Receptors:

    • New World arenaviruses typically use transferrin receptor 1 (TfR1) as their primary receptor

    • Some arenaviruses also utilize α-dystroglycan (α-DG)

    • Screening receptor candidates can be performed using receptor knockout cell lines or receptor competition assays

  • Quantitative Binding Assays:

    • Surface Plasmon Resonance (SPR) to determine binding kinetics and affinity

    • ELISA-based binding assays with purified receptors and GPC

    • Flow cytometry with GPC-coated beads binding to receptor-expressing cells

  • Mutagenesis Analysis:

    • Based on studies with LCMV, residues like S153, L260, H155, and A211 influence α-DG binding affinity

    • Creating recombinant viruses or pseudoviruses with point mutations can identify critical receptor-binding residues

    • Competition assays with soluble receptors can confirm the functional impact of mutations

For example, in studies with LCMV, the H155Y mutation significantly enhanced binding to α-DG :

Virus StrainMutationα-DG Binding Affinity
WE HPI (Wild type)-Low
WE HPIH155YHigh
WE HPIA211TLow
WE HPIH155Y + H136RPoor (uses alternate receptor)
WE HPIH155Y + R190APoor (uses alternate receptor)

Similar methodological approaches can be applied to identify and characterize the receptor-binding residues of Pirital virus GPC.

What are the most effective methods for evaluating neutralizing antibody responses against Pirital virus GPC?

Evaluating neutralizing antibody responses against Pirital virus requires robust assays that can accurately measure antibody function. Based on approaches used with other arenaviruses, the following methodologies are recommended:

  • Pseudovirus Neutralization Assays:

    • Generate lentivirus-based pseudoviruses expressing Pirital virus GPC

    • Quantify neutralization using luciferase or GFP reporters

    • Calculate IC50 values to determine neutralization potency

    • This system allows testing without the need for BSL-3/4 containment

  • Recombinant Virus Systems:

    • Create chimeric viruses where a backbone virus (like LCMV) expresses Pirital virus GPC

    • These systems can provide a more accurate assessment of how antibodies affect viral propagation

    • Plaque reduction neutralization tests (PRNT) with these viruses measure functional neutralization

  • Antibody Epitope Mapping:

    • Competitive binding assays determine if antibodies target overlapping epitopes

    • Escape mutant analysis identifies critical residues for neutralization

    • Structural studies of antibody-GPC complexes reveal precise binding sites

  • B Cell Repertoire Analysis:

    • Immune repertoire sequencing can characterize the antibody response

    • Analysis of V-J gene usage patterns can provide insights into the quality of the response

    • Based on LASV studies, prefusion-stabilized trimeric GPC immunogens induce unique V-J pairing biases compared to monomeric forms

For example, in LASV GPCv2 studies, the most frequently used V-J pairing in mice immunized with trimeric GPCv2 was IGHV1S3001:IGHJ201, differing from the IGHV2-602:IGHJ401 pairing predominant in monomeric GPC immunization . This suggests that antigen structure influences the antibody repertoire generated.

What strategies can be employed to design stabilized Pirital virus GPC immunogens that elicit potent neutralizing antibodies?

Designing effective GPC-based vaccines for Pirital virus would benefit from structure-guided approaches similar to those used for other arenaviruses. Key methodological strategies include:

  • Prefusion Stabilization:

    • Proline substitutions in the hinge regions between GP1 and GP2 can stabilize the prefusion conformation

    • For LASV, replacing the amino acid at position 328 with proline stabilized the prefusion form

    • Similar structure-based approaches could identify optimal proline substitution sites in Pirital virus GPC

  • Trimerization Domains:

    • Appending trimerization domains (like T4 fibritin foldon) to the C-terminus of GP2 promotes stable trimers

    • This maintains critical quaternary epitopes that span multiple protomers

    • The resulting trimers should be validated by negative-stain EM or analytical ultracentrifugation

  • Glycan Engineering:

    • Strategically removing or relocating N-linked glycans can expose neutralizing epitopes

    • Maintaining the natural glycan shield in non-epitope regions helps generate relevant antibodies

    • Glycan knockout mutants should be tested to ensure they still maintain native prefusion conformation

  • Antigenic Assessment:

    • New immunogens should be validated using panels of neutralizing and non-neutralizing antibodies

    • Thermal stability assays can confirm improved stability of engineered constructs

    • Cryo-EM or X-ray crystallography should verify the native-like prefusion conformation

Based on LASV studies, prefusion-stabilized trimeric GPC immunogens (like GPCv2) induce significantly higher neutralizing antibody titers than monomeric forms . In mice, GPCv2 generated neutralizing antibody titers with IC50 values ranging from 20 to 80, whereas the monomeric form failed to induce consistent neutralizing responses .

How does adjuvant selection impact the quality and durability of immune responses against Pirital virus GPC immunogens?

Adjuvant selection is critical for optimizing immune responses to Pirital virus GPC vaccines. Based on studies with related arenaviruses, the following methodological considerations are important:

  • Adjuvant Comparison Studies:

    • Test multiple adjuvant formulations in parallel (alum+CpG, AddaVax, AS01e, R848)

    • Evaluate both antibody titers and neutralization potency

    • Assess durability of responses through long-term sampling points

    • Compare T cell responses, including CD4+ T follicular helper cells that support antibody development

  • Antibody Quality Assessment:

    • Analyze antibody affinity maturation through avidity assays

    • Determine IgG subclass distribution, as this reflects the type of immune response

    • In LASV studies, prefusion-stabilized GPC elicited comparable IgG1 and IgG2a titers, indicating a balanced Th1/Th2 response

  • Immune Repertoire Analysis:

    • Sequencing the B cell receptor repertoire can reveal how different adjuvants shape the antibody response

    • Analyzing somatic hypermutation rates provides insights into affinity maturation

    • With LASV GPCv2, higher frequencies of unique IGHV precursors were observed in the trimeric immunogen group, potentially contributing to superior neutralizing responses

  • Challenge Studies:

    • Test protection against pseudovirus or recombinant virus challenge

    • Evaluate correlates of protection by passive transfer of serum or monoclonal antibodies

    • Assess for potential antibody-dependent enhancement effects

In LASV studies, regardless of the adjuvant used (Al+CpG, Addvax, AS01e, or R848), the prefusion-stabilized trimeric GPCv2 consistently elicited significantly higher anti-GPC antibody and neutralization titers compared to monomeric forms . This suggests that the structural properties of the immunogen may be more important than adjuvant selection, though optimal adjuvants can further enhance these responses.

What are the primary obstacles in developing broadly protective immunogens against diverse Pirital virus strains and related arenaviruses?

Developing broadly protective immunogens against Pirital virus and related arenaviruses faces several significant challenges:

  • Sequence Diversity:

    • Arenaviruses show considerable sequence diversity, requiring bNAb responses to neutralize multiple virus lineages

    • The GPC of arenaviruses can vary significantly between strains and species

    • Strategies to address this include:

      • Consensus sequence design

      • Mosaic immunogens incorporating epitopes from multiple strains

      • Identifying and targeting conserved neutralizing epitopes

  • Dense Glycan Shield:

    • Arenavirus GPCs are covered by dense glycan shields that restrict antibody access to underlying protein epitopes

    • This makes GPC a poorly immunogenic antigen

    • Methodological approaches include:

      • Targeted glycan removal to expose conserved epitopes

      • Glycan repositioning to maintain shielding while allowing access to neutralizing epitopes

      • Immunofocusing strategies that direct the immune response to exposed vulnerable sites

  • Metastability of the Prefusion Conformation:

    • The prefusion state is metastable and can readily convert to the postfusion form

    • Additional stabilization strategies beyond those already identified may be necessary

    • Combining multiple stabilizing mutations may provide more robust prefusion stabilization

  • Limited Animal Models:

    • The lack of authentic virus challenge models hampers comprehensive assessment of vaccine efficacy

    • Developing improved animal models that recapitulate human disease would accelerate vaccine development

    • Alternative assessment models, potentially using humanized mice or chimeric viruses, need further development

Future directions should incorporate artificial intelligence techniques to assist in antigen design , combination of different vaccine platforms for improved efficacy and safety, and more in-depth investigation of protection mechanisms induced by prefusion-stabilized GPC vaccines.

How can structural knowledge of Pirital virus GPC guide the rational design of broadly neutralizing antibodies for therapeutic applications?

Structural knowledge of arenavirus GPCs can inform the rational design of broadly neutralizing antibodies (bNAbs) through several methodological approaches:

  • Structure-Guided Antibody Engineering:

    • Crystal structures of GPC-antibody complexes reveal precise epitopes and binding modes

    • Computational modeling can predict how mutations might improve binding affinity or breadth

    • Antibody optimization strategies include:

      • CDR engineering to enhance binding to conserved epitopes

      • Framework modifications to improve stability

      • Fc engineering to enhance effector functions or half-life

  • Identification of Broadly Neutralizing Epitopes:

    • Structural comparison of diverse arenavirus GPCs can identify conserved vulnerable sites

    • Neutralizing antibodies targeting these conserved regions may have pan-arenavirus activity

    • Multi-protomer (quaternary) epitopes spanning the trimeric interface are often targets of potent neutralizing antibodies

  • Antibody Cocktail Development:

    • Combining antibodies targeting non-overlapping epitopes can provide broader coverage

    • This approach reduces the likelihood of escape mutations

    • Structural information guides the selection of complementary antibodies

  • Bispecific Antibody Design:

    • Structural knowledge enables the creation of bispecific antibodies targeting multiple epitopes

    • These constructs can simultaneously bind to different regions of GPC

    • The design can be optimized based on epitope accessibility and spatial arrangements

By leveraging structural information about GPC conformational states and epitope accessibility, researchers can rationally design antibody therapeutics with improved potency, breadth, and resistance to viral escape mutations. This approach has been successful for other viral pathogens and holds promise for developing effective countermeasures against Pirital virus and related arenaviruses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.