Recombinant Pisaster ochraceus NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Description

Introduction to Pisaster ochraceus NADH-Ubiquinone Oxidoreductase Chain 3

NADH-ubiquinone oxidoreductase chain 3 (ND3) is one of several mitochondrially-encoded subunits of complex I in the electron transport chain. In Pisaster ochraceus, ND3 functions as part of the large mitochondrial complex that catalyzes the transfer of electrons from NADH to ubiquinone, coupled with proton translocation across the inner mitochondrial membrane. The recombinant form of this protein has been produced for research purposes, enabling detailed biochemical and structural studies.

The Pisaster ochraceus mitochondrial genome has been extensively characterized, with ND3 identified as one of several protein-coding genes within a continuous 8.0-kb fragment. This segment contains multiple respiratory chain components, including NADH dehydrogenase subunits (ND1, ND2, ND3, and ND4L), cytochrome oxidase subunits (COI, COII, and COIII), and adenosine triphosphatase subunits (ATPase 6 and ATPase 8) . Within this genomic organization, the ND3 gene has been found to be located adjacent to the serine (UCN) tRNA gene .

Production and Expression Systems

The recombinant Pisaster ochraceus ND3 protein is typically produced using bacterial expression systems, specifically Escherichia coli. This approach allows for efficient production of the protein for research applications. The gene encoding ND3 is cloned into an appropriate expression vector and transformed into E. coli host cells for protein production .

To facilitate purification, the recombinant protein is engineered with an N-terminal histidine tag (His-tag). This affinity tag enables purification using immobilized metal affinity chromatography (IMAC), resulting in preparations with purity greater than 90% as determined by SDS-PAGE analysis .

Mitochondrial Genome Organization

The ND3 gene occupies a specific position within the mitochondrial genome of Pisaster ochraceus. The gene arrangement in sea star mitochondrial DNA has been found to differ from that of other organisms, representing a novel gene order. In P. ochraceus, the serine (UCN) tRNA gene is positioned between COIII and ND3, which is one of the distinguishing features of the sea star mitochondrial genome organization .

The complete sequencing of over 9 kb of the mitochondrial genome from P. ochraceus has revealed that the ND3 gene is part of a continuous 8.0-kb fragment containing multiple protein-coding genes involved in oxidative phosphorylation . This genomic organization provides insights into the evolution of mitochondrial genomes in echinoderms and their relationship to other metazoan lineages.

Comparative Genomics

Recent genomic studies have expanded our understanding of Pisaster ochraceus biology beyond individual genes to the whole-genome level. The first complete genome and annotation for P. ochraceus has been reported, enabling comprehensive analyses of gene expression patterns across different tissues, size classes, and health conditions . While these studies did not specifically focus on ND3, they provide a broader genomic context in which to understand the role and regulation of mitochondrial genes in this species.

Biological Significance and Function

As a component of respiratory complex I, ND3 plays a crucial role in mitochondrial energy metabolism. This protein is involved in the first step of the electron transport chain, contributing to the establishment of the proton gradient that drives ATP synthesis. The specific functional domains within the ND3 protein and their contributions to complex I activity remain areas of ongoing research.

The study of ND3 and other mitochondrial proteins has gained additional relevance in the context of sea star wasting disease (SSWD), a condition that has caused significant mortality in sea star populations along the Pacific coast of North America. While direct links between ND3 and SSWD have not been established, differential gene expression analyses have revealed changes in metabolic pathways during disease progression .

Basic Biochemical Research

Recombinant Pisaster ochraceus ND3 protein serves as a valuable tool for investigating fundamental aspects of mitochondrial complex I structure and function. Applications include:

  • Structural studies of complex I components

  • Protein-protein interaction analyses

  • Biochemical characterization of electron transport

  • Comparative studies of respiratory complexes across species

Disease-Related Research

The availability of recombinant ND3 protein has potential implications for research on sea star wasting disease (SSWD), a condition characterized by lesions, tissue degradation, and eventual death in affected sea stars. Recent genomic studies have identified differential gene expression patterns in Pisaster ochraceus during SSWD progression, with significant changes observed in the pyloric caecum tissue . While these studies did not specifically implicate ND3, they highlight the importance of understanding metabolic processes that might be affected during disease states.

Histopathological analyses of SSWD in P. ochraceus have shown various tissue abnormalities, including epidermal ulceration, edema, and ossicle degradation . The potential role of mitochondrial function in these pathological changes represents an area for further investigation, where recombinant proteins like ND3 could serve as valuable research tools.

Future Research Directions

Several promising avenues exist for future research involving recombinant Pisaster ochraceus ND3:

  1. Structural characterization of P. ochraceus complex I and its components

  2. Investigation of potential post-translational modifications of ND3

  3. Comparative studies of ND3 function across echinoderm species

  4. Exploration of potential connections between mitochondrial function and sea star wasting disease

  5. Development of antibodies and other research reagents specific to P. ochraceus ND3

As genomic and proteomic technologies continue to advance, more detailed characterization of this protein and its functional significance will likely emerge, contributing to our understanding of both basic mitochondrial biology and sea star physiology.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Pisaster ochraceus (Ochre sea star) (Asterias ochracea)
Target Names
ND3
Target Protein Sequence
MYNIIIIVLSILAVTAALVFAAHFLPSRKLDLENGSPYECGFDPLNSARVPFSFRFFLVA ILFLLFDLEIALLFPFPQALFIFNSSHVLYIATLFLAILLIGLIFEWTQGGLDWAE
Uniprot No.

Target Background

Function
As a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), this protein is believed to be part of the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the biological role of NADH-ubiquinone oxidoreductase chain 3 in Pisaster ochraceus?

NADH-ubiquinone oxidoreductase chain 3 (ND3) is a mitochondrial protein component of Complex I in the electron transport chain, essential for cellular respiration in Pisaster ochraceus. While specific research on ND3 in P. ochraceus is limited, we can infer from studies on related proteins such as ND4L that these proteins play critical roles in energy metabolism. Similar to ND4L, ND3 likely functions in the transfer of electrons from NADH to ubiquinone, contributing to the generation of the proton gradient necessary for ATP synthesis . In P. ochraceus, this energy production is vital for various physiological processes, including movement, feeding, and survival in challenging intertidal environments where the species experiences temperature fluctuations and desiccation stress .

How does ND3 differ structurally and functionally from ND4L in Pisaster ochraceus?

While both ND3 and ND4L are components of Complex I in the mitochondrial respiratory chain, they differ in their amino acid sequence, length, and specific functional roles. Based on comparative analysis with ND4L (which has a sequence of 98 amino acids in P. ochraceus), ND3 likely has a unique amino acid composition and tertiary structure that determines its specific position and function within the Complex I assembly . ND3 typically contains transmembrane domains that anchor it in the inner mitochondrial membrane, whereas ND4L (as seen in the sequence data) contains primarily hydrophobic residues forming multiple membrane-spanning regions . These structural differences reflect their complementary but distinct roles in electron transport.

What expression systems are most effective for producing recombinant Pisaster ochraceus ND3?

For recombinant expression of Pisaster ochraceus ND3, bacterial systems (particularly E. coli) often provide reasonable yields, though eukaryotic systems may be necessary for proper folding of this membrane protein. Based on approaches used with similar mitochondrial proteins, researchers should consider:

  • BL21(DE3) E. coli strains with codon optimization for P. ochraceus genetic code

  • Baculovirus-insect cell systems for enhanced post-translational modifications

  • Yeast expression systems (S. cerevisiae or P. pastoris) for membrane proteins

Success has been reported with fusion tags such as those used for ND4L protein production, which include appropriate storage buffers (Tris-based with 50% glycerol) to maintain stability . When designing expression constructs, researchers should account for the hydrophobic nature of ND3 and consider solubility-enhancing fusion partners.

How can researchers differentiate between genetic and environmental factors affecting ND3 function in studies of sea star wasting disease?

Differentiating between genetic and environmental factors affecting ND3 function in sea star wasting disease (SSWD) research requires a multi-faceted approach:

  • Genomic analysis: Compare ND3 sequences from affected and unaffected populations to identify potential genetic variants, similar to approaches used for studying EF1A polymorphisms in P. ochraceus . This can help determine if specific ND3 variants correlate with disease susceptibility.

  • Transcriptomic assessment: Analyze ND3 expression levels under controlled environmental conditions versus disease states to isolate environmental triggers from genetic predispositions.

  • Experimental design: Implement split-family designs where genetically related individuals are exposed to different environmental conditions (temperature, pH, contaminants) while monitoring ND3 function and disease progression.

  • Protein functionality assays: Develop in vitro assays to measure electron transport efficiency of different ND3 variants under various conditions that mimic environmental stressors.

This approach allows researchers to parse whether mitochondrial dysfunction in SSWD is primarily driven by genetic vulnerabilities in ND3 or by environmental factors such as DDT contamination, which has been linked to wasting disease in P. ochraceus .

What methodological approaches best resolve contradictory findings regarding mitochondrial protein involvement in sea star thermal tolerance?

To resolve contradictory findings regarding mitochondrial protein involvement in sea star thermal tolerance, researchers should implement the following methodological approaches:

  • Standardized stress protocols: Establish uniform temperature challenge methodologies similar to those used in previous P. ochraceus studies, where individuals were maintained in flow-through systems with controlled temperature parameters .

  • Multi-level analysis: Combine:

    • Genomic analysis of mitochondrial genes including ND3

    • Proteomic quantification of protein abundance

    • Direct measurement of enzyme activity and electron transport rates

    • Metabolomic profiling of downstream energy metabolites

  • Population stratification: Account for geographic variation by sampling P. ochraceus from multiple locations along its range (Alaska to Baja California) , controlling for local adaptation.

  • Technical replication validation: Use multiple technical approaches to verify findings, such as combining capillary electrophoresis with next-generation sequencing as demonstrated in EF1A studies .

  • Meta-analysis framework: Develop a standardized reporting format for thermal tolerance studies to facilitate direct comparison across laboratories and studies.

This comprehensive approach helps identify whether contradictions stem from methodological differences, population variation, or genuine biological complexity in how mitochondrial proteins like ND3 contribute to thermal tolerance.

What are the optimal purification protocols for maintaining the native conformation of recombinant P. ochraceus ND3?

For optimal purification of recombinant P. ochraceus ND3 while maintaining native conformation, researchers should consider the following protocol:

Purification Protocol Table:

StepMethodBuffer CompositionCritical Parameters
1. ExtractionGentle detergent solubilization50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1% DDM or LMNGTemperature: 4°C; Detergent:protein ratio: 5:1
2. Initial CaptureImmobilized metal affinity chromatography (IMAC)Above buffer + 20 mM imidazoleFlow rate: 0.5 ml/min; Binding time: 2 hours
3. Intermediate PurificationIon exchange chromatography20 mM Tris-HCl pH 7.5, 0.05% detergent, gradient of 0-500 mM NaClMonitor conductivity and UV absorbance
4. PolishingSize exclusion chromatography20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.02% detergentColumn: Superdex 200; Flow rate: 0.3 ml/min
5. StorageFlash freezing in aliquotsAbove buffer + 50% glycerolStorage temperature: -80°C

This protocol draws upon approaches used for similar membrane proteins, including the P. ochraceus ND4L, which requires specific buffer conditions (Tris-based buffer with 50% glycerol) for stability . The critical considerations include:

  • Detergent selection: Mild detergents preserve native-like membrane environments

  • Buffer components: pH stability is essential for maintaining tertiary structure

  • Quality control: CD spectroscopy to verify secondary structure integrity

  • Functional validation: Activity assays to confirm electron transport capability

These approaches help overcome the inherent difficulties of working with hydrophobic mitochondrial membrane proteins while preserving their functional characteristics.

How can researchers design experiments to investigate the role of ND3 in sea star wasting disease progression?

To investigate the role of ND3 in sea star wasting disease (SSWD) progression, researchers should design experiments that integrate molecular, physiological, and ecological approaches:

  • Comparative expression studies:

    • Sample collection from healthy, early-stage, and advanced disease P. ochraceus specimens

    • Quantitative PCR and western blot analysis to track ND3 expression changes during disease progression

    • RNA-seq to identify co-regulated genes and pathways

  • Functional mitochondrial assays:

    • Oxygen consumption measurements in isolated mitochondria from healthy and diseased tissues

    • Specific Complex I activity assays using recombinant ND3 complementation

    • ROS production quantification to assess oxidative stress levels

  • Environmental manipulation experiments:

    • Controlled exposure studies using flow-through seawater chambers as utilized in previous P. ochraceus research

    • Introduction of suspected SSWD triggers (temperature stress, pathogens, contaminants like DDT)

    • Time-course sampling to track ND3 modifications and mitochondrial function

  • In vivo imaging techniques:

    • Development of fluorescent probes for mitochondrial function in sea star tissues

    • Longitudinal imaging of disease progression correlated with mitochondrial parameters

These approaches should be implemented with appropriate controls and replication, maintaining sea stars in conditions that mimic their natural intertidal habitat with attention to temperature fluctuations, feeding regimes, and water quality parameters .

What analytical methods are most sensitive for detecting conformational changes in ND3 under varying pH and temperature conditions?

For detecting conformational changes in Pisaster ochraceus ND3 under varying pH and temperature conditions, researchers should employ a combination of complementary analytical methods:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV CD (190-250 nm) to monitor secondary structure changes

    • Near-UV CD (250-350 nm) to detect tertiary structure alterations

    • Temperature ramps (10-50°C) to determine thermal transition points

    • pH titrations (pH 5.0-9.0) to identify pH-dependent conformational shifts

  • Intrinsic Fluorescence Spectroscopy:

    • Excitation at 280 nm with emission scans from 300-400 nm

    • Tryptophan fluorescence peak position and intensity as indicators of conformational changes

    • Time-resolved measurements to capture transient intermediates

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Region-specific solvent accessibility changes under varying conditions

    • Temperature and pH-dependent exchange kinetics

    • Data visualization with heat maps showing protection factors across the protein sequence

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • 2D HSQC experiments to monitor residue-specific environmental changes

    • Temperature coefficients of amide proton chemical shifts

    • pH titration series to identify key ionizable groups affecting conformation

These methods are particularly relevant given P. ochraceus' natural habitat, where it experiences significant environmental fluctuations including temperature changes, pH variations from rainfall, and desiccation stress . The analytical approaches should be calibrated to detect changes within physiologically relevant parameters, including the temperature range experienced in intertidal zones and pH fluctuations common in coastal ecosystems.

How can researchers resolve aggregation issues when working with recombinant P. ochraceus ND3?

Aggregation of recombinant Pisaster ochraceus ND3 presents a significant challenge due to its hydrophobic nature as a mitochondrial membrane protein. Researchers can implement the following strategies to resolve aggregation issues:

  • Optimization of Expression Conditions:

    • Reduce expression temperature to 16-18°C

    • Use weaker promoters to slow production rate

    • Add specific chaperones (GroEL/ES, DnaK) to assist folding

    • Consider cell-free expression systems for direct incorporation into nanodiscs

  • Solubilization Strategies:

    • Screen detergent panel (DDM, LMNG, digitonin) at various concentrations

    • Test mixed micelle systems with lipid supplementation

    • Implement amphipol exchange for long-term stability

    • Consider bicelle or nanodisc reconstitution for native-like environment

  • Buffer Optimization:

    • Include osmolytes (glycerol, sucrose, arginine) to prevent aggregation

    • Test pH ranges that minimize aggregation (typically pH 7.0-8.0)

    • Add specific ions that stabilize tertiary structure

    • Screen additives like ATP or NADH that may stabilize conformation

  • Analytical Assessment:

    • Use dynamic light scattering to monitor aggregation state

    • Employ analytical ultracentrifugation to quantify monomer/oligomer distributions

    • Implement thermal shift assays to identify stabilizing conditions

    • Utilize SEC-MALS to determine absolute molecular weight of species

These approaches should be implemented systematically, with careful documentation of conditions that reduce aggregation while preserving native structure and function. Storage in optimized buffer systems (similar to the Tris-based buffer with 50% glycerol used for P. ochraceus ND4L) can help maintain long-term stability of the purified protein.

What statistical approaches best detect subtle differences in ND3 activity between healthy and diseased sea star populations?

For detecting subtle differences in ND3 activity between healthy and diseased Pisaster ochraceus populations, researchers should implement sophisticated statistical approaches that account for biological variability while maximizing sensitivity:

  • Mixed-Effects Modeling:

    • Account for nested data structures (individuals within populations, repeated measures)

    • Include random effects for collection site and genetic background

    • Incorporate environmental covariates (temperature, pH, contaminant levels)

    • Model specification example: lmer(ND3_activity ~ disease_state + temperature + (1|population) + (1|individual))

  • Bayesian Inference Approaches:

    • Implement Markov Chain Monte Carlo (MCMC) methods for parameter estimation

    • Incorporate prior information from preliminary studies

    • Generate posterior probability distributions for differences between populations

    • Calculate Bayes factors to quantify evidence for subtle effects

  • Non-parametric Multivariate Analysis:

    • PERMANOVA for simultaneously analyzing multiple ND3-related parameters

    • Distance-based redundancy analysis to correlate environmental factors with activity patterns

    • Multivariate changepoint detection to identify disease progression thresholds

  • Time Series Analysis:

    • Generalized additive mixed models (GAMMs) for non-linear activity trends during disease progression

    • Functional data analysis to compare entire activity curves rather than discrete timepoints

    • Wavelets analysis for detecting periodic patterns in activity data

These approaches should be coupled with rigorous sampling designs that consider the natural history of P. ochraceus, including its distribution from Alaska to Baja California and potential local adaptations. Power analyses should be conducted a priori to ensure sufficient sample sizes for detecting effect sizes of biological relevance, particularly given the variability observed in studies of sea star wasting disease .

How can researchers distinguish between experimental artifacts and genuine biological effects when studying post-translational modifications of ND3?

Distinguishing between experimental artifacts and genuine biological effects when studying post-translational modifications (PTMs) of Pisaster ochraceus ND3 requires rigorous experimental design and analytical validation:

  • Control Implementation:

    • Isotope-labeled internal standards for accurate PTM quantification

    • Parallel processing of recombinant and native ND3 samples

    • Inclusion of non-physiological controls (e.g., heat-denatured samples)

    • Sequential enzymatic treatments to verify PTM identity

  • Validation Across Multiple Techniques:

    Technical ApproachPrimary DataValidation MethodArtifact Control
    Mass SpectrometryPTM site identificationTargeted MRM analysisSynthetic peptide standards
    Western BlottingPTM abundancePTM-specific antibodiesPhosphatase/deacetylase treatments
    Functional AssaysActivity correlationSite-directed mutagenesisEnzymatic removal of PTMs
    In vivo LabelingDynamic PTM turnoverPulse-chase experimentsMock treatment controls
  • Statistical Rigor:

    • False discovery rate control in PTM site identification

    • Bayesian modeling of technical and biological variability

    • Permutation testing to establish significance thresholds

    • Power analysis to determine minimum detectable effect sizes

  • Biological Validation:

    • Correlation with physiological states relevant to P. ochraceus ecology

    • Comparison across developmental stages and environmental conditions

    • Evolutionary conservation analysis across related species

    • In vitro reconstitution to verify functional consequences

This approach is particularly important given the environmental stressors that P. ochraceus naturally encounters in intertidal zones, including temperature fluctuations, desiccation, and exposure to contaminants , all of which could influence PTM patterns through both biological and artifactual mechanisms.

How might comparative studies of ND3 across echinoderm species inform our understanding of mitochondrial adaptation to environmental stress?

Comparative studies of NADH-ubiquinone oxidoreductase chain 3 (ND3) across echinoderm species offer significant potential for understanding mitochondrial adaptation to environmental stress, particularly in the context of changing marine conditions:

  • Evolutionary Rate Analysis:

    • Calculation of dN/dS ratios to identify selection signatures on ND3 in different echinoderm lineages

    • Correlation of evolutionary rates with habitat-specific stressors (temperature range, desiccation risk, pollution exposure)

    • Identification of convergent adaptive changes in species from similar ecological niches

  • Structure-Function Relationships:

    • Comparative homology modeling of ND3 across species with different stress tolerances

    • Identification of conserved versus variable regions in relation to functional domains

    • In silico prediction of how amino acid substitutions affect protein stability under stress conditions

  • Environmental Correlation Studies:

    • Sampling echinoderms along environmental gradients (latitude, depth, pollution exposure)

    • Correlation of ND3 sequence/structure variants with measured physiological tolerance metrics

    • Development of predictive models for how ND3 variants contribute to organismal resilience

  • Experimental Testing:

    • Heterologous expression of ND3 variants from different species

    • Functional assays under controlled stress conditions (temperature, pH, oxidative stress)

    • CRISPR-based introduction of ND3 variants across species to test adaptive hypotheses

This research would build upon the known ecological adaptations of P. ochraceus to its intertidal environment, where it experiences significant temperature fluctuations and can tolerate up to 30% loss of body weight through desiccation , potentially through mitochondrial adaptations that other echinoderms may share or have evolved independently.

What emerging technologies could enhance our ability to study ND3 function in situ in live sea star tissues?

Emerging technologies offer exciting opportunities to study NADH-ubiquinone oxidoreductase chain 3 (ND3) function in situ in live Pisaster ochraceus tissues:

  • Advanced Imaging Technologies:

    • Multiphoton microscopy with genetically encoded mitochondrial voltage indicators

    • FLIM (Fluorescence Lifetime Imaging Microscopy) to measure NADH/NAD+ ratios

    • Super-resolution microscopy (STED, PALM) for submitochondrial localization of ND3

    • Label-free imaging using Coherent Anti-Stokes Raman Spectroscopy (CARS) for metabolic profiling

  • Genetically Encoded Biosensors:

    • CRISPR-mediated tagging of endogenous ND3 with fluorescent proteins

    • Development of FRET-based sensors for conformational changes in ND3

    • Optogenetic tools to modulate ND3 function with light

    • Proximity labeling approaches (BioID, APEX) to map dynamic ND3 interactions

  • Microfluidic and Organoid Technologies:

    • Sea star tissue-on-chip systems for controlled microenvironment manipulation

    • Primary culture of sea star mitochondria-rich tissues with in situ monitoring

    • Organoid development from sea star pluripotent cells for developmental studies

    • Microelectrode arrays for real-time monitoring of mitochondrial electrical activity

  • Nanoscale Delivery Systems:

    • Targeted nanoparticles for delivery of ND3 modulators to specific tissues

    • Cell-penetrating peptides for introduction of labeled antibodies against ND3

    • Injectable nanobiosensors for longitudinal studies in individual sea stars

    • Biodegradable implants for controlled release of metabolic tracers

These technologies would be particularly valuable for studying P. ochraceus in contexts relevant to ongoing conservation concerns, such as sea star wasting disease , allowing researchers to monitor mitochondrial function in real-time during disease progression or environmental stress exposure.

How can systems biology approaches integrate ND3 function into broader models of sea star metabolism and stress response?

Systems biology approaches offer powerful frameworks for integrating ND3 function into comprehensive models of Pisaster ochraceus metabolism and stress response:

  • Multi-omics Integration:

    • Combined analysis of genomics, transcriptomics, proteomics, and metabolomics data

    • Weighted gene co-expression network analysis to identify ND3-associated regulatory modules

    • Correlation of ND3 expression/modification patterns with global metabolic shifts

    • Development of sea star-specific metabolic flux models incorporating mitochondrial function

  • Network Modeling Approaches:

    • Protein-protein interaction networks centered on Complex I components

    • Bayesian network inference to identify causal relationships in stress response pathways

    • Agent-based modeling of cellular responses to mitochondrial dysfunction

    • Constraint-based modeling (e.g., flux balance analysis) of energy metabolism during stress

  • Dynamical Systems Analysis:

    • Ordinary differential equation models of electron transport chain kinetics

    • Sensitivity analysis to identify critical control points in mitochondrial function

    • Bifurcation analysis to identify tipping points in system behavior

    • Parameter estimation from time-course experimental data during stress exposure

  • Ecological Integration:

    • Linking cellular-level models to population-level responses

    • Incorporating environmental variables relevant to P. ochraceus habitat (tidal cycles, temperature fluctuations)

    • Predicting ecosystem-level consequences of altered mitochondrial function

    • Integration with models of sea star wasting disease progression

This systems-level understanding would provide context for how ND3 function contributes to P. ochraceus' remarkable adaptations to intertidal life, including tolerance to temperature fluctuations, desiccation (up to 30% body weight loss), and other environmental stressors , while potentially revealing new insights into disease resilience and physiological adaptation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.