Recombinant Pisaster ochraceus NADH-ubiquinone oxidoreductase chain 4L (ND4L)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Complex I

ND4L is essential for Complex I assembly and activity. Studies in Chlamydomonas reinhardtii demonstrate that the absence of ND4L disrupts the 950-kDa Complex I structure and abolishes enzyme activity . In humans, the homologous MT-ND4L gene encodes a mitochondrial-encoded subunit critical for electron transport chain efficiency .

Key Functional Insights:

  • Electron Transport: ND4L stabilizes interactions between hydrophilic and hydrophobic domains of Complex I, enabling NADH-to-ubiquinone electron transfer .

  • Assembly Dependency: Hydrophobic subunits like ND4L are necessary for proper Complex I folding and membrane integration .

Comparative Insights from Model Organisms

While ND4L in Pisaster ochraceus is recombinant, its function mirrors endogenous subunits in other species:

OrganismND4L Characteristics
Homo sapiensMitochondrial-encoded; part of Complex I core subunits .
Chlamydomonas reinhardtiiNuclear-encoded; critical for Complex I assembly .
Pichia pastorisPart of a 41-subunit Complex I with 14 core subunits .

Critical Considerations for Handling and Use

  • Stability: Lyophilized protein should be reconstituted in sterile water to minimize aggregation .

  • Buffer Compatibility: Tris-based buffers are optimized for stability, but avoid low-pH conditions .

  • Contamination Risks: His-tagged proteins may bind metal ions; use EDTA-free buffers if needed .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To specify a tag type, please inform us for preferential development.
Synonyms
ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Pisaster ochraceus (Ochre sea star) (Asterias ochracea)
Target Names
ND4L
Target Protein Sequence
MSSYLTIIISFFYLGILGILLNRLHLLSILLCFELLLISLFIWICNTLFKTFNNLILSNN LILLTLSACEASAGLSLMVALSRTHNSDLVSSMNILQQ
Uniprot No.

Target Background

Function

A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly required for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.