Recombinant Pisum sativum Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Pisum sativum (Garden pea)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQVKQV LANGKKGALNVGAVLILPEGFELAPPHRLSPQIKEKIGNLSFQSYRPTKKNILVIGPVPG KKYSEITFPILSPDPATKRDVYFLKYPLYVGGNRGRGQIYPDGSKSNNNVSNATATGVVK QIIRKEKGGYEITIVDASDGSEVIDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLLFLASIILAQILLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Pisum sativum Apocytochrome f and why is it important in research?

Apocytochrome f (petA) is a critical component of the photosynthetic electron transport chain in Pisum sativum (garden pea). The protein is encoded by the petA gene and functions within the cytochrome b6f complex, facilitating electron transfer between photosystems II and I . The recombinant form of this protein allows researchers to study photosynthetic mechanisms, protein-protein interactions, and electron transport pathways without the complexity of whole-cell systems. Its importance extends to understanding fundamental aspects of photosynthesis, plant metabolism, and potential applications in synthetic biology and bioengineering.

The amino acid sequence of this protein (YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQVKQVLANGKKGALNVGAVLILPEGFELAPPHRLSPQIKEKIGNLSFQSYRPTKKNILVIGPVPGKKYSEITFPILSPDPATKRDVYFLKYPLYVGGNRGRGQIYPDGSKSNNNVSNATATGVVKQIIRKEKGGYEITIVDASDGSEVIDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLLFLASIILAQILLVLKKKQFEKVQLSEMNF) contains critical domains responsible for its functionality, including heme binding sites and interaction surfaces for electron transport partners .

How should Recombinant Pisum sativum Apocytochrome f be stored and handled in a laboratory setting?

Proper storage and handling of Recombinant Pisum sativum Apocytochrome f is crucial for maintaining protein integrity and experimental reproducibility. The recommended storage conditions are -20°C for regular use, and -80°C for extended storage periods . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for protein stability .

For laboratory work, researchers should follow these methodological guidelines:

  • Avoid repeated freeze-thaw cycles as these can significantly reduce protein activity and stability

  • Prepare working aliquots and store at 4°C for up to one week to minimize freeze-thaw damage

  • When handling the protein, maintain cold chain conditions to prevent denaturation

  • Use appropriate buffer systems compatible with the planned experimental applications

  • Consider adding protease inhibitors if working with crude lysates or in applications where proteolytic degradation might occur

The protein's stability can be verified before use through techniques such as SDS-PAGE or western blotting to ensure experimental reliability .

What expression systems are commonly used for producing Recombinant Pisum sativum Apocytochrome f?

For the production of functional Recombinant Pisum sativum Apocytochrome f, researchers have developed several expression systems, each with specific advantages. The expression region typically encompasses amino acids 36-320 of the full-length protein, which contains the functional domains necessary for most research applications .

Commonly employed expression systems include:

For optimal results, researchers should consider codon optimization for the selected expression system and include appropriate affinity tags to facilitate purification. The specific tag type will typically be determined during the production process based on the intended experimental applications .

How can Recombinant Pisum sativum Apocytochrome f be incorporated into artificial photosynthetic systems?

Incorporating Recombinant Pisum sativum Apocytochrome f into artificial photosynthetic systems represents an advanced application at the intersection of biochemistry, synthetic biology, and materials science. The methodological approach involves several strategic steps:

  • Protein orientation and immobilization: The cytochrome must be immobilized on conductive surfaces while maintaining its native conformation. This can be achieved through site-specific chemical conjugation strategies targeting non-essential residues or through genetic engineering approaches introducing specific attachment points.

  • Electron transfer partner integration: For functional artificial systems, researchers must incorporate appropriate electron donors and acceptors that can interface with Apocytochrome f. This might include plastocyanin or engineered alternatives with optimized electron transfer properties.

  • Stability enhancement: The protein should be stabilized using approaches such as:

    • Cross-linking with bifunctional reagents

    • Incorporation into nanodiscs or liposomes

    • Encapsulation in sol-gel matrices or hydrogels

    • Design of protective microenvironments mimicking the thylakoid membrane

  • Redox potential tuning: Site-directed mutagenesis can be employed to modify the heme environment, allowing researchers to fine-tune the redox potential to match specific artificial system requirements.

What are the current challenges and limitations in structural studies of Pisum sativum Apocytochrome f?

Structural studies of Pisum sativum Apocytochrome f face several methodological challenges that researchers should be aware of:

  • Membrane protein crystallization barriers: As a membrane-associated protein, Apocytochrome f presents inherent crystallization difficulties. Researchers have found some success using:

    • Lipidic cubic phase crystallization

    • Detergent screening approaches

    • Fusion protein strategies to increase solubility

    • Nanobody or antibody fragment co-crystallization to stabilize flexible regions

  • Heterogeneity challenges: Expression systems may produce protein with variable post-translational modifications or folding states. Methods to address this include:

    • Size exclusion chromatography coupled with multi-angle light scattering

    • Mass spectrometry approaches to verify homogeneity

    • Single-particle cryo-EM as an alternative to crystallography

  • Functional state capture: Capturing different functional states during the electron transport cycle represents a significant challenge. Researchers are employing:

    • Time-resolved structural techniques

    • The use of electron transport inhibitors to trap specific states

    • Site-directed spin labeling combined with EPR spectroscopy

  • Protein-protein interaction interfaces: Understanding how Apocytochrome f interacts with its electron transport partners requires specialized approaches:

    • Hydrogen-deuterium exchange mass spectrometry

    • Cross-linking mass spectrometry

    • Molecular dynamics simulations calibrated with experimental data

Recent advances in cryo-EM techniques offer promising avenues for overcoming some of these limitations, particularly for studying the protein within its native complex.

How can researchers optimize electron transfer studies involving Recombinant Pisum sativum Apocytochrome f?

Electron transfer studies with Recombinant Pisum sativum Apocytochrome f require careful methodological consideration. The following optimization strategies are recommended:

  • Electrode surface modification: For electrochemical studies, researchers should:

    • Test multiple electrode materials (gold, carbon, indium tin oxide)

    • Implement self-assembled monolayers to control orientation

    • Consider nanostructured electrodes for increased surface area

    • Use impedance spectroscopy to characterize the electrode-protein interface

  • Spectroelectrochemical approaches: Combined optical and electrochemical measurements provide powerful insights:

    • UV-visible absorption changes during redox transitions

    • Resonance Raman spectroscopy for heme environment characterization

    • Time-resolved fluorescence for kinetic analysis

  • Protein partner selection: When studying electron transfer between Apocytochrome f and its partners:

    • Use both native and modified plastocyanin or cytochrome c6

    • Consider fluorescently labeled partners for FRET-based measurements

    • Engineer distance variations to establish electron transfer distance dependencies

  • Data analysis frameworks: Advanced data analysis approaches include:

    • Marcus theory fitting to determine reorganization energies

    • Molecular dynamics simulations to identify electron transfer pathways

    • Quantum mechanical calculations to estimate coupling strengths

Researchers should be particularly attentive to solution conditions, as pH, ionic strength, and the presence of specific ions can significantly impact electron transfer rates and mechanisms.

What are the best approaches for studying Apocytochrome f interactions with other proteins in the photosynthetic electron transport chain?

Studying interactions between Apocytochrome f and other components of the photosynthetic electron transport chain requires robust methodological approaches. Based on current research practices, the following techniques yield the most reliable results:

  • Surface plasmon resonance (SPR) studies:

    • Immobilize one partner (typically Apocytochrome f) on a sensor chip

    • Flow the interacting partner over the surface at varying concentrations

    • Determine association and dissociation rates under different buffer conditions

    • This approach is particularly valuable for quantifying how factors like ionic strength affect interaction kinetics

  • Microscale thermophoresis (MST):

    • Label one protein partner with a fluorescent probe

    • Measure thermophoretic movement in response to temperature gradients

    • Calculate binding affinities based on thermophoretic mobility shifts

    • This technique requires minimal sample amounts and can be performed in solution

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Use antibodies specific to Apocytochrome f to pull down interaction complexes

    • Analyze by mass spectrometry to identify all binding partners

    • Quantify relative abundances to determine interaction strengths

    • This approach is valuable for discovering previously unknown interactions

  • Förster resonance energy transfer (FRET) analysis:

    • Generate fluorescently labeled versions of Apocytochrome f and potential partners

    • Measure energy transfer as an indicator of physical proximity

    • Perform in reconstituted membrane systems or liposomes to mimic the native environment

    • This technique provides spatial information about the interaction interface

When designing such experiments, researchers should carefully consider the orientation of proteins, particularly when using affinity tags, as these may interfere with natural interaction surfaces.

What controls and validation steps are essential when working with Recombinant Pisum sativum Apocytochrome f?

Rigorous experimental design when working with Recombinant Pisum sativum Apocytochrome f necessitates comprehensive controls and validation steps:

  • Protein quality assessment:

    • SDS-PAGE analysis to confirm size and purity

    • Circular dichroism spectroscopy to verify secondary structure integrity

    • UV-visible spectroscopy to assess heme incorporation and environment

    • Mass spectrometry to confirm protein identity and detect potential modifications

  • Functional validation:

    • Redox potential measurements using potentiometric titrations

    • Electron transfer activity assays with native electron partners

    • Binding assays with known interaction partners like plastocyanin

    • Reconstitution into liposomes to verify membrane association capability

  • Essential experimental controls:

    • Denatured protein controls to distinguish specific from non-specific effects

    • Site-directed mutants with altered key residues as negative controls

    • Wild-type protein from native source as positive control when available

    • Buffer-only and irrelevant protein controls to identify system artifacts

  • Replication requirements:

    • Minimum of three biological replicates using independent protein preparations

    • Technical replicates to assess measurement variability

    • Validation of key findings using complementary methodological approaches

    • Tests across different protein batches to ensure reproducibility

These rigorous validation steps ensure that experimental observations are truly attributable to the functional properties of Apocytochrome f rather than artifacts or contamination.

How can researchers effectively troubleshoot issues with Recombinant Pisum sativum Apocytochrome f activity?

When encountering problems with Recombinant Pisum sativum Apocytochrome f activity, researchers should implement a systematic troubleshooting approach:

  • Protein integrity issues:

    • Verify heme incorporation using absorption spectroscopy (characteristic peaks at ~410 nm and ~550 nm)

    • Check for proteolytic degradation using western blotting with antibodies targeting different protein regions

    • Assess aggregation state using size exclusion chromatography or dynamic light scattering

    • Measure redox potential to confirm the heme environment is correctly formed

  • Expression and purification optimization:

    • Test multiple expression temperatures (16°C often improves folding of complex proteins)

    • Vary induction conditions (inducer concentration and timing)

    • Screen different detergents or solubilization strategies if membrane association is problematic

    • Consider adding heme precursors to the growth medium to improve heme incorporation

  • Activity assay refinement:

    • Optimize buffer conditions (pH, ionic strength, presence of specific ions like Ca²⁺)

    • Test different electron donors/acceptors for compatibility

    • Implement oxygen-free conditions for redox-sensitive applications

    • Consider the addition of small molecules that might stabilize the native conformation

  • Common issues and solutions matrix:

ProblemPossible CausesDiagnostic ApproachSolution Strategies
No detectable activityImproper folding, Heme loss, DenaturationAbsorption spectroscopy, Circular dichroismRefolding protocols, Heme reconstitution
Low activityPartial denaturation, Suboptimal bufferThermal stability assay, Buffer screeningStabilizing additives, Buffer optimization
Inconsistent resultsBatch variation, Oxidative damageBatch comparison by SEC, ROS detectionStandardize prep protocol, Add antioxidants
Rapid activity lossProteolytic degradation, AggregationSDS-PAGE time course, DLS measurementsAdd protease inhibitors, Optimize storage

This systematic approach allows researchers to identify and address specific issues affecting protein activity, improving experimental reliability and reproducibility.

How can spectroscopic methods be used to characterize Recombinant Pisum sativum Apocytochrome f?

Spectroscopic characterization of Recombinant Pisum sativum Apocytochrome f provides critical insights into its structural integrity and functional properties. The following methodological approaches are particularly valuable:

  • UV-visible absorption spectroscopy:

    • The reduced form typically shows characteristic peaks at approximately 552, 524, and 423 nm

    • The oxidized form exhibits peaks at approximately 408 nm

    • The ratio of Soret band (400-420 nm) to protein absorbance (280 nm) indicates heme incorporation efficiency

    • Spectral shifts can reveal information about the heme environment and ligand binding

  • Circular dichroism (CD) spectroscopy:

    • Far-UV CD (190-250 nm) provides information about secondary structure content

    • Near-UV CD (250-350 nm) reflects tertiary structure fingerprints

    • Visible-region CD can provide information specific to the heme environment

    • Thermal melting curves generated by monitoring CD signal changes can determine stability parameters

  • Resonance Raman spectroscopy:

    • Excitation in the Soret band region selectively enhances vibrations associated with the heme

    • Specific marker bands indicate the oxidation and spin state of the heme iron

    • Changes in band positions can reveal details about axial ligands and heme pocket structure

    • This technique is particularly valuable for characterizing the active site environment

  • EPR spectroscopy:

    • Provides detailed information about the electronic structure of the heme iron

    • Different g-values are characteristic of specific coordination environments

    • Temperature-dependent measurements can reveal magnetic coupling information

    • This technique is especially useful for studying the oxidized state of the protein

When implementing these spectroscopic approaches, researchers should carefully control sample conditions, particularly pH and oxidation state, as these factors significantly impact spectral properties.

What genomic and transcriptomic approaches are valuable for studying petA gene expression in Pisum sativum?

Research into the genomic and transcriptomic aspects of petA gene expression in Pisum sativum offers valuable insights into regulatory mechanisms and evolutionary relationships. Current methodological approaches include:

  • Genome sequencing and comparative genomics:

    • High-throughput sequencing technologies enable detailed analysis of the petA locus and surrounding regions

    • Comparative analysis across pea cultivars reveals conservation patterns and variation

    • Studies have shown that cultivars like 'Triumph', 'Vendevil', and 'Classic' can be sequenced and mapped to reference genomes like 'Frisson' with over 90% unambiguous mapping

    • Genomic analysis can identify regulatory elements controlling petA expression

  • Transcriptomic profiling under varying conditions:

    • RNA-Seq approaches quantify petA expression levels across developmental stages and environmental conditions

    • Differential expression analysis identifies co-regulated genes that may function in related pathways

    • In studies of pea cultivars, thousands of genes show differential expression patterns that can be linked to specific traits or responses

    • Time-course experiments can reveal the temporal dynamics of gene expression

  • Promoter analysis and transcription factor identification:

    • Reporter gene assays using petA promoter constructs identify regulatory regions

    • Yeast one-hybrid screens can identify transcription factors binding to the petA promoter

    • ChIP-Seq approaches map in vivo binding sites genome-wide

    • Analysis of promoter sequences can reveal potential regulatory elements, as demonstrated in studies comparing cultivars with different symbiotic responses

  • Small RNA and epigenetic regulation:

    • Small RNA sequencing identifies potential regulatory RNAs targeting petA expression

    • Bisulfite sequencing reveals DNA methylation patterns in the petA locus

    • ChIP-Seq for histone modifications characterizes the chromatin environment

    • These approaches can identify epigenetic factors contributing to expression regulation

These genomic and transcriptomic techniques provide a multi-dimensional understanding of petA gene regulation in Pisum sativum, contributing to both fundamental knowledge and potential applications in crop improvement.

What mass spectrometry approaches are most effective for studying post-translational modifications of Apocytochrome f?

Post-translational modifications (PTMs) of Apocytochrome f can significantly influence its function and interactions. Mass spectrometry offers powerful tools for characterizing these modifications:

For Apocytochrome f, researchers should pay particular attention to redox-based modifications of cysteine residues, potential phosphorylation sites, and modifications that might affect heme coordination or protein-protein interactions.

How does Pisum sativum Apocytochrome f compare to homologs from other plant species?

Comparative analysis of Apocytochrome f across plant species provides valuable evolutionary and functional insights:

  • Sequence conservation and divergence patterns:

    • The core functional domains of Apocytochrome f show high conservation across plant species

    • The heme-binding site typically exhibits near-absolute conservation

    • The largest sequence variations occur in loop regions and the membrane-anchoring domain

    • N-terminal sequences show greater variability than the core electron transfer domain

    • Phylogenetic analysis clusters sequences according to expected evolutionary relationships

  • Structural comparison across species:

    • X-ray crystallography studies reveal highly similar tertiary structures despite sequence differences

    • The position and orientation of the heme group remain consistent across species

    • Species-specific differences in surface charge distribution may influence interaction kinetics

    • These structural comparisons help identify residues critical for function versus those tolerant to substitution

  • Functional divergence assessment:

    • Electron transfer kinetics can vary between species, even with conserved structural features

    • These variations may reflect adaptation to different environmental conditions

    • Cross-species electron transfer studies with plastocyanin partners reveal compatibility patterns

    • Such studies illuminate the co-evolution of electron transfer partners

  • Evolutionary rate analysis:

    • The petA gene typically shows a moderate evolutionary rate compared to other photosynthetic genes

    • Positive selection analysis can identify residues under adaptive pressure

    • These analyses provide insights into the evolutionary constraints on electron transport proteins

    • Correlation with environmental factors may reveal adaptive patterns

This comparative approach not only illuminates evolutionary relationships but also helps identify conserved functional elements that might be critical targets for structure-function studies.

What role does Apocytochrome f play in plant-microbe symbiotic relationships?

Recent research has uncovered interesting connections between photosynthetic electron transport components, including Apocytochrome f, and plant-microbe symbiotic relationships:

  • Metabolic integration with symbiotic processes:

    • Photosynthetic activity provides carbon compounds essential for symbiotic nitrogen fixation

    • Studies of pea cultivars have shown that symbiotic responsivity traits can be influenced by genes related to photosynthetic efficiency

    • Analysis of pea cultivars like 'Triumph', 'Classic', and 'Vendevil' has demonstrated differential gene expression patterns related to symbiotic responses

    • The expression of genes involved in nodule formation and arbuscular mycorrhizal (AM) fungi colonization appears to be coordinated with photosynthetic gene networks

  • Transcriptional coordination evidence:

    • Genomic and transcriptomic studies have identified genes involved in both symbiotic nodule development and photosynthetic processes

    • Under combined inoculation with nodule bacteria and AM fungi, cultivars with high symbiotic responsivity show characteristic expression patterns that include genes related to solute transport, hormone regulation, and flavonoid biosynthesis

    • Differential gene expression analysis has identified hundreds of genes that respond to inoculation with symbiotic microorganisms

  • Methodological approaches for studying these relationships:

    • Transcriptomic profiling under various symbiotic conditions

    • Metabolic flux analysis to track carbon allocation

    • Comparative analysis of mutants affected in both symbiotic and photosynthetic processes

    • These studies typically involve measuring parameters like nodule formation, mycorrhizal colonization rates, and changes in plant biomass

  • Breeding implications:

    • Understanding the genetic basis of symbiotic responsivity can inform breeding programs

    • Genomic analysis has shown that trait donors like 'Vendevil' can contribute genes related to symbiotic efficiency when crossed with other cultivars

    • The identification of markers associated with improved symbiotic response could accelerate breeding efforts

This research area represents an emerging field connecting photosynthetic efficiency with symbiotic relationships, with potential applications in sustainable agriculture and plant breeding.

How is Recombinant Pisum sativum Apocytochrome f being used in synthetic biology applications?

Recombinant Pisum sativum Apocytochrome f is finding novel applications in synthetic biology, representing an exciting frontier in research:

  • Engineered electron transport chains:

    • Researchers are designing simplified electron transport modules incorporating Apocytochrome f

    • These systems can be used to study fundamental electron transfer principles

    • By controlling component stoichiometry and orientation, researchers can optimize electron flux

    • Such engineered systems provide insights not accessible in complex native environments

  • Biosensor development:

    • The redox-active properties of Apocytochrome f make it useful in biosensor applications

    • By coupling electron transfer to detectable outputs (electrochemical, optical), specific analytes can be detected

    • Site-directed mutagenesis can modify specificity for different electron donors

    • These approaches require careful optimization of protein orientation and electron coupling

  • Methodological considerations for synthetic applications:

    • Protein engineering to add functional domains or attachment sites

    • Surface chemistry optimization for controlled immobilization

    • Integration with nano-materials like quantum dots or carbon nanotubes

    • These factors significantly impact the performance of synthetic systems

  • Biohybrid energy conversion:

    • Integration of photosynthetic proteins with artificial photosensitizers

    • Construction of biohybrid electrodes for solar energy conversion

    • Design of systems coupling electron transport to catalytic reactions

    • Such applications represent promising avenues for sustainable energy research

When designing such synthetic biology applications, researchers must carefully consider protein stability, electron transfer efficiency, and appropriate interfacing with other biological or artificial components.

What are the latest techniques for studying the dynamics of Apocytochrome f in membrane environments?

Understanding the behavior of Apocytochrome f in membrane environments requires sophisticated methodological approaches that capture both structural and dynamic aspects:

  • Advanced microscopy techniques:

    • Single-molecule fluorescence microscopy tracks individual protein molecules

    • Super-resolution approaches like STORM or PALM achieve nanometer-scale resolution

    • FRET-based measurements reveal conformational changes during function

    • These techniques require careful fluorophore selection and labeling strategies

  • Membrane mimetic systems:

    • Nanodiscs provide a defined membrane environment with controlled composition

    • Liposomes of varying complexity model thylakoid membrane properties

    • Supported bilayers enable surface-sensitive measurements

    • These systems can be systematically varied to study the impact of lipid composition

  • Molecular dynamics simulations:

    • All-atom simulations provide atomic-level details of protein-membrane interactions

    • Coarse-grained approaches enable longer timescale simulations

    • Integration with experimental data improves simulation accuracy

    • These computational approaches reveal dynamic behaviors difficult to capture experimentally

  • Time-resolved spectroscopic methods:

    • Ultrafast transient absorption spectroscopy captures electron transfer events

    • Time-resolved fluorescence measures conformational dynamics

    • 2D-IR spectroscopy provides structural information on fast timescales

    • These approaches require specialized instrumentation and careful data analysis

By combining these complementary techniques, researchers can build comprehensive models of how Apocytochrome f functions within the membrane environment, including its lateral mobility, orientation, conformational flexibility, and interactions with lipids and other proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.