Recombinant Pisum sativum ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pisum sativum ATP Synthase Subunit a, Chloroplastic (atpI)

Recombinant Pisum sativum ATP synthase subunit a, chloroplastic (atpI) refers to the engineered production of the atpI gene-encoded protein, a critical component of the F₀ sector in chloroplast ATP synthase. This enzyme catalyzes ATP synthesis via proton translocation across the thylakoid membrane in photosynthetic organisms. The recombinant protein is expressed in E. coli and purified for structural, functional, or biochemical studies.

Proton Translocation Mechanism

  • Subunit a facilitates proton re-entry into the stroma via its α-helical structure (aH1–aH6), interacting with the c-ring .

  • Proton Motive Force: The F₀F₁ ATP synthase in chloroplasts generates ATP by harnessing the proton gradient across thylakoid membranes .

Production Methodology

  • Expression Host: E. coli is used for high-yield production due to its efficient recombinant protein machinery .

  • Purification: Affinity chromatography (via His tag) followed by buffer exchange to stabilize the protein .

Research Applications

  1. Structural Studies:

    • Protein-Protein Interactions: Investigating subunit a’s role in F₀F₁ assembly and proton channel formation .

    • Mutagenesis: Engineering subunit a to study proton translocation efficiency or ATP synthase regulation .

  2. Functional Assays:

    • ATP Synthase Activity: Reconstituting recombinant subunit a with other F₀F₁ subunits to measure proton-driven ATP synthesis .

    • Stress Response: Analyzing subunit a’s stability under oxidative or osmotic stress in pea chloroplasts .

Potential Challenges and Future Directions

  • Low Detection in Proteomics: Hydrophobic subunits like a (atpI) are often underrepresented in MS analyses, requiring specialized techniques .

  • Stoichiometric Variation: Engineering subunit a to modulate proton flux could optimize ATP synthesis in crops .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Pisum sativum (Garden pea)
Target Names
atpI
Target Protein Sequence
MNVLLCYINTLNRFYDISAVEVGQHFYWQIGDFQVHAQVLITSWVVIAILLISTILVVRN PQTIPTSGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWKII KLPHGELAAPTNDINTTVALALLTSVAYFYAGISKKGLAYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
As a key component of the proton channel, it plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of ATP synthase subunit a (atpI) in chloroplasts of Pisum sativum?

ATP synthase subunit a (atpI) is a critical component of the FO portion of the ATP synthase complex located in the thylakoid membrane of chloroplasts. This protein forms part of the proton channel that facilitates the translocation of protons across the thylakoid membrane. The movement of these protons down the electrochemical gradient drives the rotation of the c-ring, which in turn powers the conformational changes in F1 that lead to ATP synthesis.

The atpI subunit works in conjunction with other subunits to maintain the proton gradient essential for photosynthetic energy conversion. In Pisum sativum (garden pea), this protein is particularly important for maintaining optimal ATP synthesis rates under varying environmental conditions, contributing to the plant's energy homeostasis .

How does the atpI-atpH region function as a chloroplast marker in molecular studies?

The atpI-atpH region in the chloroplast genome is frequently used as a molecular marker for phylogenetic studies and species identification due to several advantageous characteristics:

  • High amplification success rate (though slightly lower than some other chloroplast markers at approximately 92%)

  • Considerable sequence length (1,187 bp), providing adequate polymorphism for analysis

  • High number of variable sites and indels (99), making it useful for distinguishing between closely related species

  • Moderate haplotype diversity, indicating its utility in population genetic studies

Comparatively, the atpI-atpH region shows higher variable sites than matK and psbA-trnH, though it has lower haplotype diversity than psbA-trnH. When used in species discrimination studies, atpI-atpH performs moderately well, with improved results when combined with other markers such as matK, psbA-trnH, and ycf1 .

What are the standard methods for isolating and purifying recombinant atpI protein?

Standard isolation and purification of recombinant Pisum sativum atpI involves:

  • Cloning and vector selection: The atpI gene can be cloned into expression vectors such as pET-22B, which allows for the addition of histidine tags for purification. This approach is similar to the methodology used for PsNTP9 apyrase, another Pisum sativum protein .

  • Bacterial expression system: Transformation into Escherichia coli BL21 strain containing the T7 promoter, which enables IPTG-mediated induction of protein expression .

  • Induction conditions: Typically, protein expression is induced using IPTG when bacterial cultures reach appropriate density (OD600 ~0.6-0.8).

  • Cell lysis: Cells are harvested and disrupted using lysis buffer, often with mechanical shaking to release the recombinant protein .

  • Purification: Initial separation via centrifugation to isolate the protein-containing fraction, followed by affinity chromatography using the histidine tag.

  • Verification: SDS-PAGE and Western blotting to confirm protein identity and purity.

This approach has been successful for other Pisum sativum proteins and can be adapted specifically for atpI purification with appropriate modifications to buffer compositions and purification conditions based on the protein's physical properties.

What expression systems are most effective for producing functional recombinant atpI?

While several expression systems can be used for recombinant atpI production, the E. coli system remains the most widely adopted due to:

  • Rapid growth: E. coli cultures grow quickly, allowing for faster experimental cycles.

  • Established protocols: Methods for transformation, induction, and protein extraction are well-established, as demonstrated in similar studies with Pisum sativum proteins .

  • Genetic tools: The availability of various strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3), which are derivatives of BL21.

  • Vector compatibility: Compatibility with vectors like pET-22B that can add purification tags and provide tight control of expression .

  • Cell-free expression systems: Useful for potentially toxic membrane proteins

  • Yeast expression: For proteins requiring eukaryotic post-translational modifications

  • Plant expression systems: For maintaining native folding environment, though with lower yields

The choice depends on research objectives, required protein quantity, and functional assay requirements.

How do mutations in the atpI gene affect proton translocation mechanisms in ATP synthase?

Mutations in the atpI gene can significantly impact proton translocation and ATP synthesis efficiency through several mechanisms:

  • Alterations in proton path: Studies with E. coli F1FO ATP synthase, which shares functional similarity with chloroplastic ATP synthase, have demonstrated that specific residues in subunit-a create proton pathways. Mutations in these residues can disrupt the proton translocation pathway, affecting the 11° and 25° rotational sub-steps observed during ATP synthesis .

  • Impact on proton gradient: The electrical and proton gradients across thylakoid membranes are essential for ATP synthase function. Mutations that alter the interaction between subunit-a and the c-ring can affect the maintenance of these gradients, directly impacting ATP synthesis efficiency .

  • Grotthuss mechanism disruption: Evidence suggests that proton translocation through FO operates via a Grotthuss mechanism involving a column of water molecules. Mutations in key residues of subunit-a can disrupt this mechanism, affecting proton transfer events from subunit-a groups to the c-subunits in the c-ring .

  • Rotational effects: Experiments have observed pH-dependent 11° ATP synthase-direction sub-steps of the c-ring that result from H+ transfer events between subunit-a and c-subunits. Mutations can alter these sub-steps, affecting the alternating 11° and 25° rotational movements necessary for sustained ATP synthesis .

Research approaches to study these effects include site-directed mutagenesis of conserved residues, biophysical measurements of proton translocation, and structural analysis of mutant proteins.

What are the key considerations for experimental design when studying atpI functionality?

When designing experiments to study atpI functionality, researchers should consider:

  • pH dependencies: ATP synthase activity is highly pH-dependent, with proton electrochemical gradients playing a crucial role in function. Experimental design should account for pH variations and include appropriate controls for measuring pH changes in both stroma and lumen .

  • Measurement techniques: Non-invasive methods such as electrochromic pigment absorbance shift (ECS) and light scattering (LS) are valuable for investigating electrical and proton gradients across thylakoid membranes. These techniques can be applied to intact leaves or leaf segments to maintain physiological relevance .

  • Protein-protein interactions: The interaction between subunit-a and the c-ring is essential for ATP synthase function. Techniques such as co-immunoprecipitation, FRET, or cross-linking studies can provide insights into these interactions.

  • Rotational dynamics: Specialized techniques are required to measure the rotational steps of the c-ring and subunit-γ, which are essential for understanding the mechanistic details of ATP synthesis .

  • Stress conditions: Plant responses to biotic or abiotic stress can influence ATP synthase activity through changes in ATP release into the extracellular matrix (ECM) and subsequent signaling pathways .

Experimental protocols should be designed to address these factors while minimizing artifacts from sample preparation or measurement techniques.

How can researchers differentiate between functional and non-functional recombinant atpI protein?

Differentiating between functional and non-functional recombinant atpI requires a combination of structural and functional assays:

  • ATP synthesis activity: The gold standard for functionality is measuring ATP synthesis rates in reconstituted liposomes containing the purified recombinant atpI along with other necessary ATP synthase subunits. This can be quantified using luciferase-based ATP detection assays.

  • Proton pumping assays: Functionality can be assessed by measuring proton translocation across membranes using pH-sensitive fluorescent dyes such as ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine.

  • Rotational analyses: Single-molecule techniques can be employed to observe the rotational movements associated with functional ATP synthase complexes. Detection of the characteristic 11° and 25° sub-steps would indicate functional incorporation of atpI .

  • Structural integrity: Circular dichroism (CD) spectroscopy can assess secondary structure content, while thermal stability assays can indicate proper folding of the recombinant protein.

  • Binding assays: The ability of recombinant atpI to interact with other ATP synthase subunits, particularly c-subunits, can be assessed using surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC).

A combination of these approaches provides a comprehensive assessment of recombinant atpI functionality, distinguishing between properly folded, functional protein and misfolded or inactive forms.

What strategies can overcome expression challenges for membrane proteins like atpI?

Expressing membrane proteins such as atpI presents several challenges, which can be addressed through the following strategies:

  • Expression vector optimization:

    • Use vectors with tightly controlled promoters to prevent leaky expression

    • Incorporate fusion partners that enhance solubility or membrane targeting

    • Test different affinity tags positions (N-terminal vs. C-terminal) to determine optimal configuration

  • Host strain selection:

    • Utilize specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression

    • Consider Lemo21(DE3) strain that allows tunable expression levels

    • Test expression in different bacterial compartments (cytoplasmic, periplasmic, inclusion bodies)

  • Expression conditions:

    • Lower growth temperature (16-25°C) to slow protein synthesis and improve folding

    • Optimize induction parameters (inducer concentration, induction time, culture density)

    • Supplement media with specific lipids that may facilitate proper folding

  • Solubilization and purification:

    • Screen multiple detergents or detergent mixtures for optimal solubilization

    • Test different buffer compositions to maintain protein stability

    • Implement purification protocols that minimize time and maximize protein integrity

  • Structural stabilization:

    • Include specific lipids during purification that stabilize the protein structure

    • Use nanodiscs or amphipols as alternatives to detergents for maintaining native-like environment

    • Consider co-expression with partner proteins that may enhance stability

These approaches have been successful with other membrane proteins and can be adapted specifically for atpI expression based on its unique characteristics.

How does the proteomics profile of Pisum sativum seeds relate to ATP synthase expression?

Proteomics analysis of Pisum sativum seeds provides insights into ATP synthase expression patterns during development:

  • Developmental regulation: Proteomics studies of pea seeds at different growth stages (4, 7, 12, 15 days after anthesis [DAA] and at maturity) reveal dynamic expression patterns of energy metabolism proteins, including ATP synthase components .

  • Relationship with carbohydrate metabolism: ATP synthase expression appears coordinated with key enzymes involved in carbohydrate metabolism. For example, sucrose synthase, which catalyzes the reversible cleavage of sucrose into fructose and UDP-glucose or ADP-glucose, shows peak abundance at 12-15 DAA, suggesting coordinated energy production during peak seed development .

  • Growth stage specificity: Different ATP synthase subunits show varying expression patterns across growth stages, reflecting changing energy demands during seed development. This temporal regulation highlights the importance of selecting appropriate developmental stages for studying specific ATP synthase components.

The table below summarizes the relative abundance patterns of key energy metabolism enzymes across pea seed development stages:

Protein4 DAA7 DAA12 DAA15 DAAMaturityFunction
Sucrose synthaseLowModerateHighHighLowEnergy production, carbohydrate synthesis
Starch synthase (SS2)LowModerateHighHighModerateStarch biosynthesis
AGALVery lowLowModerateHighHighestAcid α-galactosidase activity

This developmental expression pattern provides context for understanding when and how ATP synthase components, including atpI, may be regulated during seed development .

What are the best methods for analyzing atpI sequence conservation across species?

To analyze atpI sequence conservation across plant species, researchers should employ a comprehensive approach:

  • Multiple sequence alignment (MSA): Use software such as MUSCLE, MAFFT, or T-Coffee to align atpI sequences from diverse plant species. This reveals conserved regions that may be functionally important.

  • Phylogenetic analysis: Construct phylogenetic trees using maximum likelihood or Bayesian methods to understand evolutionary relationships and selection pressures on atpI.

  • Comparative metrics: Calculate diversity statistics including:

    • Variable sites and parsimony-informative sites

    • Nucleotide diversity (π)

    • Haplotype diversity (Hd)

  • Genetic distance calculation: Determine p-distances between sequences using software like MEGA 7.0.21 to quantify divergence between species or taxonomic groups .

  • Principal coordinate analysis (PCoA): Implement PCoA using tools like GenAlEx 6.5 to visualize both the similarity between different taxonomic sections and the genetic diversity within each section .

Based on analyses of other chloroplast markers, researchers should expect atpI to show substantial sequence conservation across related species, with specific variable regions that can serve as diagnostic characters for species identification.

How does atpI compare to other chloroplast markers for molecular studies?

Comparative analysis of atpI-atpH with other chloroplast markers reveals important distinctions in their utility for molecular studies:

MarkerAligned Length (bp)Variable SitesIndelsHaplotype Diversity (Hd)Intraspecific VariationInterspecific DivergenceAmplification Success (%)
atpI-atpH1,187High99ModerateModerateModerate92.2
matK554Low3LowLowestLowest100
psbA-trnHModerateLow26HighestHighestHighest100
ycf1HighModerate43ModerateHighHigh100

Key observations:

  • The atpI-atpH region has the longest aligned length and highest number of indels among common chloroplast markers

  • psbA-trnH exhibits the highest haplotype diversity and interspecific divergence, making it potentially more useful for species discrimination

  • atpI-atpH shows moderate performance in most metrics, suggesting it works best when combined with other markers

  • No single chloroplast marker shows a distinct barcode gap between intraspecific and interspecific variation

For species identification, combined markers perform better than single markers, with combinations including atpI-atpH + matK + psbA-trnH and atpI-atpH + matK + ycf1 generating higher species resolution rates .

What are the molecular mechanisms of proton translocation through ATP synthase involving atpI?

The molecular mechanisms of proton translocation through ATP synthase involving subunit-a (atpI) include:

  • Half-channel architecture: Subunit-a forms two half-channels for proton access to and from the c-ring. Protons enter through one half-channel, bind to a c-subunit, rotate with the c-ring, and exit through the second half-channel .

  • Grotthuss mechanism: Evidence supports that proton translocation through FO operates via a Grotthuss mechanism involving a column of water molecules. This mechanism facilitates rapid proton hopping between water molecules rather than physical movement of protons through the membrane .

  • Rotational sub-steps: Experimental evidence shows pH-dependent 11° ATP synthase-direction sub-steps of the c-ring resulting from H+ transfer events. These are followed by larger 25° steps, creating alternating 11° and 25° synthase-direction rotational sub-steps that sustain ATP synthesis .

  • Key residues: Specific conserved residues in subunit-a, including those equivalent to aR210, aS199, and aE196 in E. coli, play critical roles in proton translocation. These residues interact with the aspartic acid residue (equivalent to cD61) on c-subunits to facilitate proton transfer .

  • Mixed model mechanics: Direct evidence supports a mixed model where some synthase-direction steps show characteristics of a power stroke mechanism, while others exhibit oscillations consistent with a Brownian ratchet mechanism .

Understanding these mechanisms provides insight into how atpI contributes to the essential process of converting the proton gradient energy into the mechanical energy that drives ATP synthesis.

How can researchers optimize recombinant atpI protein for structural studies?

Optimizing recombinant atpI for structural studies requires specialized approaches to overcome the challenges associated with membrane protein crystallization:

  • Construct optimization:

    • Design truncated versions that remove disordered regions while maintaining functional domains

    • Create fusion constructs with crystallization chaperones like T4 lysozyme or BRIL

    • Test thermostable orthologues from extremophile organisms that often crystallize more readily

  • Expression and purification enhancements:

    • Implement high-throughput screening to identify optimal detergent and lipid combinations

    • Use fluorescence-based thermostability assays to identify stabilizing buffer conditions

    • Incorporate lipid nanodisc or amphipol reconstitution to maintain native-like environment

  • Co-crystallization approaches:

    • Identify and co-express with binding partners that stabilize the protein

    • Use antibody fragments (Fab or nanobodies) to increase polar surface area for crystal contacts

    • Test co-crystallization with inhibitors or substrate analogues that can lock the protein in specific conformations

  • Alternative structural methods:

    • Cryo-electron microscopy (cryo-EM) for high-resolution structure determination without crystallization

    • Solid-state NMR for structural information in a lipid bilayer environment

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe dynamic regions and binding interfaces

  • Sample validation:

    • Develop functional assays to confirm that the purified protein retains native activity

    • Use circular dichroism and thermal shift assays to verify proper folding and stability

    • Implement size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to confirm monodispersity

These approaches have been successful with other challenging membrane proteins and can be adapted specifically for atpI structural studies.

How can researchers address low expression yields of recombinant atpI?

Low expression yields of recombinant atpI can be addressed through systematic optimization:

  • Codon optimization:

    • Optimize codons for the expression host to improve translation efficiency

    • Remove rare codons, especially at the 5' end of the gene

    • Adjust GC content to match the expression host

  • Expression system modifications:

    • Test different E. coli strains specialized for membrane proteins

    • Consider bacterial cell-free systems for toxic membrane proteins

    • Evaluate expression in different cellular compartments (cytoplasmic vs. membrane-targeted)

  • Vector and promoter selection:

    • Use tightly controlled promoters like T7lac to prevent leaky expression

    • Test both high-copy and low-copy vectors to determine optimal gene dosage

    • Incorporate fusion partners that enhance expression (e.g., MBP, SUMO, TrxA)

  • Culture condition optimization:

    • Screen different media formulations (rich media vs. minimal media)

    • Implement auto-induction systems for controlled protein expression

    • Optimize growth temperature, with lower temperatures (16-20°C) often improving membrane protein yields

    • Test various inducer concentrations and induction durations

  • Protein stabilization:

    • Add specific lipids or lipid mixtures to the culture medium

    • Include chemical chaperones like glycerol or arginine in the growth medium

    • Co-express with molecular chaperones like GroEL/GroES

A systematic approach to optimization, testing multiple parameters in combination, often yields the best results for challenging membrane proteins like atpI.

What are the common pitfalls in ATP synthase functional assays and how to avoid them?

Common pitfalls in ATP synthase functional assays include:

  • pH measurement inaccuracies:

    • Pitfall: Incorrect buffer selection leading to pH instability during assays

    • Solution: Use high-capacity buffers appropriate for the pH range being studied; implement continuous pH monitoring during experiments

  • Proton gradient dissipation:

    • Pitfall: Unintended dissipation of proton gradients during sample preparation

    • Solution: Minimize sample manipulation time; use non-invasive methods like electrochromic pigment absorbance shift (ECS) and light scattering (LS) measurements

  • Incomplete complex assembly:

    • Pitfall: Testing recombinant subunits without proper assembly into the complete ATP synthase complex

    • Solution: Verify complex formation using native PAGE, analytical ultracentrifugation, or electron microscopy before functional assays

  • Inhibitor specificity issues:

    • Pitfall: Using inhibitors with off-target effects that complicate interpretation

    • Solution: Include appropriate controls; use multiple structurally diverse inhibitors; confirm specificity through mutational studies

  • Detergent interference:

    • Pitfall: Detergents used for membrane protein solubilization affecting functional assays

    • Solution: Test multiple detergents; use detergent concentrations below critical micelle concentration; consider detergent-free systems like nanodiscs

  • Data interpretation challenges:

    • Pitfall: Difficulty distinguishing between rotation sub-steps and thermal noise

    • Solution: Implement high-resolution techniques; use statistical methods to analyze step sizes; collect sufficient data points for robust analysis

By anticipating these common pitfalls and implementing appropriate controls and methodological refinements, researchers can increase the reliability of ATP synthase functional assays.

How should researchers interpret contradictory results between in vitro and in vivo studies of atpI function?

When faced with contradictory results between in vitro and in vivo studies of atpI function, researchers should:

  • Evaluate experimental context:

    • In vitro systems lack the complete cellular environment, including associated proteins and lipids that may be essential for proper function

    • In vivo systems have complex regulatory networks that can compensate for experimental perturbations

  • Consider technical factors:

    • Protein modifications: Recombinant proteins often include tags or lack post-translational modifications present in vivo

    • Lipid environment: Membrane composition differs between artificial systems and native membranes

    • Proton gradient maintenance: In vitro systems may not perfectly mimic the proton gradient dynamics found in chloroplasts

  • Implement reconciliation strategies:

    • Develop intermediate systems like cell-free expression with native membranes

    • Create reconstituted systems with increasing complexity to identify minimal components needed

    • Use complementary techniques that bridge the gap between in vitro and in vivo approaches

  • Design validation experiments:

    • Introduce in vitro-identified mutations into the native organism to confirm functional impacts

    • Isolate native ATP synthase complexes for direct comparison with recombinant systems

    • Use time-resolved techniques to capture dynamic processes that may differ between systems

  • Apply systems biology approaches:

    • Model the integrated function of ATP synthase within metabolic networks

    • Consider how related processes like photosynthetic electron transport affect ATP synthase function

    • Account for homeostatic mechanisms that may mask effects in vivo

What emerging technologies are changing our understanding of atpI structure and function?

Several emerging technologies are revolutionizing our understanding of atpI structure and function:

  • Cryo-electron microscopy (cryo-EM):

    • Recent advances in cryo-EM have enabled high-resolution structures of membrane protein complexes like ATP synthase

    • This technique allows visualization of different conformational states, providing insight into the dynamic process of proton translocation

    • Cryo-EM has revealed sub-states with 11° differences between subunit-a and the c-ring, consistent with the rotational sub-steps observed in functional studies

  • Single-molecule techniques:

    • High-precision single-molecule rotation measurements can now detect the 11° and 25° sub-steps of ATP synthase rotation

    • These techniques have provided evidence for a mixed model of ATP synthase operation, with both power stroke and Brownian ratchet mechanisms

  • Time-resolved structural methods:

    • Time-resolved X-ray crystallography and spectroscopy allow observation of structural changes during the catalytic cycle

    • These approaches can capture transient states that are critical for understanding proton translocation through atpI

  • Molecular dynamics simulations:

    • Advanced computational simulations can model proton movement through water chains in the half-channels

    • These simulations provide mechanistic insights into the Grotthuss mechanism of proton translocation

  • Native mass spectrometry:

    • This technique can analyze intact membrane protein complexes with bound lipids

    • It provides information about subunit stoichiometry and lipid interactions that may be critical for atpI function

These technologies, used in combination, are driving a more complete understanding of how atpI contributes to ATP synthase function and energy conversion in chloroplasts.

How might climate change affect the evolution and function of chloroplastic ATP synthase in Pisum sativum?

Climate change may impact the evolution and function of chloroplastic ATP synthase in Pisum sativum through multiple mechanisms:

  • Temperature adaptation:

    • Rising global temperatures may select for ATP synthase variants with improved thermostability

    • Changes in kinetic properties may emerge to maintain ATP production efficiency across wider temperature ranges

  • Drought response mechanisms:

    • Water limitation affects proton gradients across thylakoid membranes

    • ATP synthase may evolve regulatory mechanisms to optimize function under fluctuating water availability

    • The interaction between ATP release, signaling pathways, and drought stress responses may become more critical

  • Carbon availability responses:

    • Elevated CO2 levels alter the balance between light and dark reactions of photosynthesis

    • ATP synthase regulation may adapt to optimize ATP:NADPH ratios under changing atmospheric CO2 concentrations

  • Photoprotection integration:

    • Increased light stress under climate change scenarios may select for tighter integration between ATP synthase regulation and photoprotective mechanisms

    • The relationship between NPQ (non-photochemical quenching) and pH changes in chloroplast compartments may evolve

  • Developmental timing adjustments:

    • Changes in growing season length and timing may alter the developmental expression patterns of ATP synthase components

    • The coordination between ATP synthase expression and carbohydrate metabolism enzymes during seed development may shift

Research approaches to study these adaptations should include comparative genomics across pea varieties from different climatic regions, experimental evolution under simulated climate change conditions, and integrated physiological studies of ATP synthase function under stress conditions.

What are the recommended protocols for students beginning research on chloroplastic ATP synthase?

For students beginning research on chloroplastic ATP synthase, the following structured approach is recommended:

  • Chloroplast isolation:

    • Start with fresh, young pea leaves harvested in the morning

    • Homogenize tissue in isolation buffer (typically containing sorbitol, HEPES, EDTA)

    • Use differential centrifugation to separate chloroplasts from other cellular components

    • Verify chloroplast integrity using microscopy and chlorophyll measurements

  • Thylakoid membrane preparation:

    • Osmotically lyse isolated chloroplasts to release thylakoid membranes

    • Wash membranes to remove stromal contaminants

    • Resuspend in appropriate buffer containing glycerol for stability

  • ATP synthase activity measurements:

    • Use non-invasive techniques like electrochromic shift (ECS) and light scattering (LS) to study proton gradients

    • Implement luciferase-based assays to measure ATP production rates

    • Monitor pH changes using fluorescent probes to track proton movement

  • Gene expression analysis:

    • Extract RNA from pea tissues at different developmental stages

    • Perform RT-PCR or qPCR using primers specific for atpI and other ATP synthase components

    • Compare expression patterns across developmental stages or stress conditions

  • Molecular marker applications:

    • Amplify the atpI-atpH region using standard PCR protocols

    • Sequence the amplified products for phylogenetic or population genetic studies

    • Compare results with other chloroplast markers like matK, psbA-trnH, and ycf1

  • Data analysis training:

    • Learn to calculate genetic diversity metrics using software like DnaSP

    • Implement phylogenetic analysis using MEGA and other specialized tools

    • Apply appropriate statistical methods to interpret experimental results

This methodological progression builds competence from basic techniques to more complex analyses while generating meaningful data on chloroplastic ATP synthase.

What bioinformatics tools are most useful for analyzing atpI sequences across plant species?

Bioinformatics analysis of atpI sequences across plant species requires a comprehensive toolkit:

  • Sequence retrieval and management:

    • NCBI Nucleotide and Protein databases for reference sequences

    • PhytozomeV13 for plant-specific genome data

    • Chloroplast Genome Database for organelle-specific sequences

    • Local sequence management tools like Geneious or SnapGene

  • Multiple sequence alignment:

    • MUSCLE: Fast and accurate alignment for large datasets

    • MAFFT: Particularly effective for sequences with conserved domains and variable regions

    • T-Coffee: Provides high accuracy for divergent sequences

    • CLUSTAL Omega: User-friendly interface with good performance for most applications

  • Phylogenetic analysis:

    • MEGA: Integrated platform for evolutionary analysis

    • RAxML: Maximum likelihood-based phylogenetic tree construction

    • MrBayes: Bayesian inference of phylogeny

    • IQ-TREE: Efficient and accurate maximum likelihood phylogenetic inference

  • Diversity and population genetics:

    • DnaSP: Calculates nucleotide diversity (π) and haplotype diversity (Hd)

    • Arlequin: Population genetic analysis software

    • GenAlEx: Excel add-in for population genetic analysis and PCoA visualization

  • Species identification tools:

    • BLOG 2.0: Uses logic mining methods for species identification

    • BLAST: Sequence similarity-based identification

    • Distance and tree-based methods for barcode analysis

  • Structural prediction and analysis:

    • SWISS-MODEL: Homology modeling of protein structures

    • PyMOL: Visualization and analysis of molecular structures

    • ConSurf: Identification of functionally important regions based on evolutionary conservation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.