Recombinant Pisum sativum Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (SYM9)

Shipped with Ice Packs
In Stock

Description

Introduction

Pisum sativum Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (SYM9) is a protein kinase in garden pea (Pisum sativum) that functions in the signal transduction pathways involved in nodulation and mycorrhizal symbiosis . Specifically, it recognizes calcium spiking induced by Nod factors and translates this signal to components that control nodulation and mycorrhizal infection responses .

General Information

CharacteristicDescription
Full NameRecombinant Pisum sativum Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (SYM9), partial
Gene NameSYM9
SpeciesPisum sativum (Garden pea)
Molecular Weight59,227 Da
NCBI Accession #Q6RET6.2
NCBI GI #71152364
UniProt Accession #Q6RET6
SynonymsPs-SYM9; PsCCaMK
PurityGreater or equal to 85% purity as determined by SDS-PAGE
SourceE. coli

Function and Structure

SYM9 is a protein kinase that plays a crucial role in plant symbiosis . Kinases, in general, catalyze the transfer of phosphate groups from high-energy, phosphate-donating molecules to specific substrates. Serine/threonine kinases are a specific family of kinases that phosphorylate serine and threonine amino acid residues in proteins. The calcium and calcium/calmodulin-dependent aspect indicates that the activity of SYM9 is regulated by calcium ions and calmodulin, a calcium-binding messenger protein .

SYM9 is similar to SYM8, which plays a vital role in both rhizobial and mycorrhizal symbioses . SYM8 is a cation channel, and a homology model of SYM8 suggests a tetrameric structure with transmembrane helices and a pore region . It is predicted that a hinge region links the pore with the gating ring, where the sym8-5 mutation is located, and this may prevent conformational changes in the gating region from being transmitted to the pore region .

Role in Nodulation and Mycorrhizal Symbiosis

SYM9 is involved in the signaling pathways that control nodulation and mycorrhizal infection in Pisum sativum .

  • Nodulation Nod factors are signaling molecules produced by rhizobia bacteria that trigger the formation of nitrogen-fixing nodules on the roots of legumes. SYM9 recognizes calcium spiking induced by Nod factors, which is an early event in the nodulation process .

  • Mycorrhizal Symbiosis Mycorrhizae are symbiotic associations between fungi and plant roots, where the plant receives nutrients from the fungus, and the fungus receives carbohydrates from the plant. SYM9 also plays a role in translating signals that control mycorrhizal infection responses .

Research and Applications

Recombinant SYM9 is used in scientific research to study plant signaling pathways, protein interactions, and enzyme functions . Understanding the structure, function, and regulation of SYM9 can provide insights into how to improve plant-microbe interactions, which can have applications in agriculture and environmental sustainability.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
SYM9; Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase; Ps-SYM9; PsCCaMK; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-527
Protein Length
full length protein
Species
Pisum sativum (Garden pea)
Target Names
SYM9
Target Protein Sequence
MEYGTRKLSDVYEVSEILGRGGFSVVRKGTRKSNNDDEKSQSQSKSQSQSQVAIKTLRRL GTSNNLPRKKDGGENSTETMMKFPTMRQVSVSDALLTNEILVMRRIVENVSPHPNVIDLY DVYEDTNGVHLVLELCSGGELFDRIVAQDKYSETEASTVVHQIVAGLEAIHRANIIHRDL KPENCLFLDVGKDSSLKIMDFGLSSVEEFTDPVVGLFGSIDYVSPEALSQGKITTKSDMW SLGVILYILLSGYPPFIAQNNRQKQQMILNGNFSFYEKTWKGISQSAKNLISSLLTVDPA KRPSAQELLSDPWVKGEKAKDDQMDPEIVSRLQRFNARRKLRAAAIASVWSSTIFLRTKK LKSLVGSYDLKEDEIENLRMHFKKICADRDNATLCEFEEVLKAMKMPSLIPFAARIFDLF DNNRDGTVDMREILCGFSSLKNSKGEDALRLCFQMYDTDRSGCITKEEVASMLRALPYDC LPTDITEPGKLDEIFDLMDANSDGKVTFDEFKAAMQRDSSLQDVVLS
Uniprot No.

Target Background

Function
A protein kinase that recognizes calcium spiking induced by Nod factors and transduces this signal to downstream components regulating nodulation and mycorrhizal infection responses.
Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, CaMK subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Pisum sativum Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (SYM9) and why is it important?

Pisum sativum Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (SYM9) is a key signaling protein involved in the legume-rhizobial symbiotic pathway. SYM9 functions downstream of calcium spiking in the Nod factor signaling pathway in pea plants . The protein has been identified as orthologous to DMI3 in Medicago truncatula, suggesting conservation of this signaling component across legume species .

The full-length SYM9 protein consists of 527 amino acids and contains domains typical of calcium and calcium/calmodulin-dependent protein kinases . Its primary function is to act as a decoder of calcium oscillations that occur in response to Nod factor perception. This calcium-sensing ability makes SYM9 crucial for translating calcium signals into downstream biological responses that ultimately lead to nodule formation and successful symbiosis.

The importance of SYM9 is highlighted by studies of sym9 mutants, which despite retaining the ability to exhibit Nod factor-induced calcium spiking, are blocked in subsequent stages of nodulation signaling . This indicates that SYM9 plays an essential role in the signal transduction pathway leading to symbiotic establishment.

What role does SYM9 play in the symbiotic signaling pathway of pea plants?

SYM9 serves as a critical component in the symbiotic signaling pathway of pea plants, particularly in the context of legume-rhizobial interactions. In this pathway, bacterial signal molecules called Nod factors are perceived by plant LysM-containing receptor-like kinases (LysM-RLKs) . This perception triggers a series of signaling events, including calcium oscillations in and around the nucleus.

As a calcium/calmodulin-dependent protein kinase, SYM9 functions downstream of these calcium oscillations, decoding the calcium signals and phosphorylating downstream targets . This activation leads to the induction of symbiotic genes and the initiation of nodule development.

The Ps-SYM9 locus has been mapped onto pea linkage group IV, at a location suggesting orthology to DMI3 in Medicago truncatula . The Ps-sym9 complementation group includes five different pea mutants: P1, P2, P53, and P54 (derivatives of Frisson) and R72 (which carries the first defined sym9 allele in the Sparkle background) . Genetic analysis of these mutants has revealed that while they retain the ability to exhibit Nod factor-induced calcium spiking, they are blocked in subsequent signaling steps, confirming SYM9's role as a decoder of calcium signals.

How does SYM9 respond to calcium signals during symbiotic interactions?

SYM9, as a calcium/calmodulin-dependent protein kinase, responds to calcium signals through a sophisticated mechanism that involves binding calcium directly or via calmodulin. During symbiotic interactions, Nod factor perception triggers calcium oscillations in and around the nucleus of root cells. These calcium spikes serve as a signature signal that SYM9 must interpret correctly for successful symbiotic development.

The precise mechanisms by which SYM9 responds to calcium signals may be analogous to those observed for other calcium-dependent kinases. For instance, studies on CaMKII (a calcium/calmodulin-dependent protein kinase in animal systems) have shown that it can act as a frequency decoder for calcium oscillations, responding differently when calcium spikes occur in quick succession . This filtering mechanism allows the kinase to integrate calcium signals at physiologically relevant frequencies.

Similar to CaMKII, SYM9 likely undergoes conformational changes upon calcium binding, exposing its catalytic domain and enabling the phosphorylation of downstream targets. This activation mechanism allows SYM9 to translate the specific pattern of calcium oscillations induced by Nod factors into appropriate cellular responses. The function of SYM9 downstream of calcium spiking is critical, as sym9 mutants exhibit normal calcium spiking but fail to progress to subsequent stages of nodulation .

How can researchers effectively design experiments to study SYM9 function in pea plants?

Designing effective experiments to study SYM9 function requires a multifaceted approach combining genetic, biochemical, and cellular techniques:

Genetic Approaches:

  • Mutant Analysis: Utilize existing sym9 mutants (P1, P2, P53, P54, and R72) to study phenotypic consequences of SYM9 dysfunction. Compare these mutants with wild-type plants in terms of nodulation, calcium spiking, and other symbiotic responses.

  • RNA Interference (RNAi): Design RNAi constructs targeting SYM9 to achieve knockdown of gene expression. This approach has been successfully used in pea plants for studying gene function in symbiotic interactions .

  • Transformation Techniques: Employ Agrobacterium rhizogenes-mediated transformation to generate composite plants with transgenic roots. This method has shown high efficiency for pea cultivars:

A. rhizogenes StrainTotal PlantsTransformed PlantsTotal Hairy RootsHairy Roots per Transformed Plant
ARqua111480 (70%)1301.6
AR11936250 (80%)881.8

Table 1: Agrobacterium rhizogenes-mediated transformation efficiency in Pisum sativum cv. Frisson

Biochemical Approaches:

  • Protein-Protein Interaction Studies: Use co-immunoprecipitation (Co-IP) to identify proteins that interact with SYM9. This approach has been successfully used to study interactions between protein kinases in pea plants .

  • Kinase Activity Assays: Develop in vitro assays to measure SYM9 kinase activity and identify potential substrates, using techniques such as radioactive labeling or phospho-specific antibodies.

Cellular and Microscopy Techniques:

  • Calcium Imaging: Use calcium-sensitive fluorescent dyes or genetically encoded calcium indicators to visualize calcium spiking in response to Nod factors and correlate these signals with SYM9 activity.

  • Phosphorylation Detection: Use phospho-specific antibodies similar to the anti-phospho-p44/42 MAPK antibodies used to detect MAPK3/6 phosphorylation in pea to monitor SYM9 activation or its downstream targets.

What challenges exist in analyzing SYM9 signaling in pea root nodulation?

Analyzing SYM9 signaling in pea root nodulation presents several technical and biological challenges:

Technical Challenges:

  • Protein Stability and Activity:

    • SYM9, being a calcium/calmodulin-dependent protein kinase, requires specific conditions to maintain its activity.

    • Solution: Optimize buffer conditions, add stabilizing agents like 6% Trehalose , and avoid repeated freeze-thaw cycles.

  • Temporal Dynamics of Signaling:

    • Calcium spiking and subsequent SYM9 activation occur with specific temporal patterns that can be difficult to capture.

    • Solution: Develop high-temporal resolution imaging techniques, similar to those used for CaMKII in neuronal systems, which achieved millisecond-range resolution for calcium-dependent kinase activation .

Biological Challenges:

  • Environmental Influences:

    • Symbiotic processes are influenced by environmental factors, making standardization difficult.

    • Solution: Conduct experiments under controlled conditions and include appropriate controls to account for environmental variables.

  • Plant Genetic Background Effects:

    • The genetic background of pea cultivars can influence SYM9 function.

    • Solution: Compare SYM9 function across different cultivars, such as Finale and Frisson , to identify consistent patterns.

Methodological Challenges:

  • Transformation Efficiency:

    • Pea transformation can be challenging, with variable efficiency depending on the cultivar and method used.

    • Solution: Optimize transformation protocols using Agrobacterium rhizogenes strains that have shown success in pea transformation .

  • Specificity of Antibodies:

    • Developing specific antibodies against SYM9 or its phosphorylated form can be challenging.

    • Solution: Use epitope-tagged versions of SYM9 or develop highly specific monoclonal antibodies against unique SYM9 peptides.

How does SYM9 interact with other proteins in the calcium signaling pathway?

Understanding SYM9's interactions with other proteins requires systematic investigation using multiple approaches:

Identification of Interaction Partners:

  • Co-Immunoprecipitation (Co-IP): This technique has been successfully used to study protein-protein interactions in pea plants . The method involves:

    • Expression of SYM9 with a tag (such as HIS or FLAG)

    • Incubation of lysates containing SYM9 and potential interacting proteins

    • Precipitation using specific antibodies or affinity resins

    • Detection of co-precipitated proteins by Western blot analysis

    This approach has been used effectively to study MAP kinase cascades in pea, as shown in Figure 7 of research by Peat et al. , and can be adapted for SYM9 studies.

Characterization of Known Interactions:

  • Calcium and Calmodulin Binding: As a calcium/calmodulin-dependent protein kinase, SYM9 likely binds directly to calcium or calcium-bound calmodulin. Specific assays to study these interactions include:

    • Calmodulin binding assays using purified recombinant SYM9

    • Calcium binding assays to determine the calcium-binding properties of SYM9

    • Mutagenesis of predicted calcium and calmodulin binding sites to assess their functional importance

  • Connection to Symbiotic Receptors: LysM receptor-like kinases (such as LYK9 and LYR4) are involved in Nod factor perception in pea . The relationship between these receptors and SYM9 can be studied through:

    • Co-IP experiments to detect physical interactions

    • Genetic analyses to determine epistatic relationships

    • Signal transduction studies to determine how receptor activation leads to SYM9 activity

Research has shown that typical intracellular signal transduction pathways involved in triggering plant responses via CERK1 receptors to chitin/chitooligosaccharides in Arabidopsis and rice may also be recruited in legume pea plants , suggesting potential conservation in signaling mechanisms that could involve SYM9.

What techniques are available for studying SYM9 phosphorylation and activation?

Studying SYM9 phosphorylation and activation requires sophisticated techniques that can detect specific post-translational modifications and measure kinase activity:

Detection of Phosphorylation Status:

  • Phospho-specific Antibodies: Developing antibodies that specifically recognize phosphorylated forms of SYM9 is a powerful approach. This method has been used successfully for detecting phosphorylated MAPKs in pea plants using anti-phospho-p44/42 MAPK antibodies (Figure 8).

  • Mass Spectrometry-based Phosphoproteomics: This technique allows for the identification of specific phosphorylation sites on SYM9. The methodological approach involves:

    • Immunoprecipitation of SYM9 from plant tissues

    • Digestion of the protein into peptides

    • Enrichment of phosphopeptides

    • Analysis by liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • Identification of phosphorylation sites using database searching

Measurement of Kinase Activity:

  • In Vitro Kinase Assays: These assays involve incubating purified recombinant SYM9 with potential substrates and ATP, followed by detection of phosphorylation. Detection methods include:

    • Radioactive assays using [γ-32P]ATP

    • Non-radioactive assays using phospho-specific antibodies

    • Mass spectrometry-based approaches to identify phosphorylation sites

Correlation with Calcium Signals:

  • Calcium Imaging Combined with Kinase Activity Assays: This approach involves simultaneously monitoring calcium levels and SYM9 activity to establish the relationship between calcium signals and kinase activation. Similar approaches have been used to study calcium-dependent kinases in other systems, such as CaMKII in neuronal cells .

  • Genetic and Pharmacological Manipulations: Using specific kinase inhibitors or calcium chelators can help establish the dependency of SYM9 activation on calcium signals and autophosphorylation.

How can researchers resolve contradictory findings about SYM9 function?

Resolving contradictory findings about SYM9 function requires a systematic approach that addresses potential sources of variability:

Standardization of Experimental Conditions:

  • Genetic Material:

    • Use well-characterized pea cultivars with known genetic backgrounds, such as Finale and Frisson .

    • Consider the impact of different pea cultivars on experimental outcomes, as demonstrated in studies using multiple cultivars .

  • Growth Conditions:

    • Standardize growth parameters (temperature, light, humidity, photoperiod).

    • Use controlled media compositions, such as Jensen medium for seedling growth .

Advanced Analytical Approaches:

  • Meta-analysis:

    • Employ Bayesian hierarchical meta-analysis to estimate likely effect sizes and quantify heterogeneity among different experiments, studies, and cultivars, similar to the approach used in a comprehensive pea root study .

    • This approach can help determine whether contradictory findings are due to statistical sampling error or represent true biological variability.

  • Multi-omics Integration:

    • Combine transcriptomic, proteomic, and phosphoproteomic data to gain a comprehensive view of SYM9 function.

    • RNA sequencing can identify differentially expressed genes in response to SYM9 activity or in sym9 mutants .

Genetic and Molecular Validation:

  • Multiple Mutant Alleles:

    • Use multiple sym9 mutant alleles (P1, P2, P53, P54, R72) to ensure that observed phenotypes are due to SYM9 dysfunction rather than background mutations.

    • Complementation studies with wild-type SYM9 can confirm that phenotypes are specifically due to sym9 mutations.

  • Cross-Species Validation:

    • Compare SYM9 function in pea with its orthologs in other legumes, such as DMI3 in Medicago truncatula .

    • This can help identify conserved functions versus species-specific roles.

How can computational modeling enhance our understanding of SYM9 function?

Computational modeling offers powerful approaches to enhance our understanding of SYM9 function:

Structural Modeling:

  • Homology Modeling: Using known structures of related calcium/calmodulin-dependent protein kinases to predict the three-dimensional structure of SYM9.

  • Molecular Dynamics (MD) Simulations: Simulating the dynamic behavior of SYM9 under different conditions to understand:

    • Conformational changes upon calcium binding

    • Interactions with calmodulin

    • Effects of phosphorylation on protein structure

Signaling Network Modeling:

  • Ordinary Differential Equation (ODE) Models: Developing mathematical models that describe the kinetics of SYM9 activation and downstream signaling events. These models can help understand:

    • How calcium oscillation patterns influence SYM9 activation

    • The temporal dynamics of signaling events

    • The effects of feedback loops in the signaling network

Calcium Signal Decoding Models:

  • Frequency-Encoding Models: Developing models that explain how SYM9 decodes the frequency of calcium oscillations, similar to studies on CaMKII in neuronal systems .

  • Application to Experimental Design: Using models to design experiments that can discriminate between alternative hypotheses about SYM9 function.

By integrating computational modeling with experimental approaches, researchers can develop a more comprehensive understanding of SYM9 function in the complex signaling networks that govern symbiotic interactions in pea plants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.