Recombinant Pisum sativum Chlorophyll a-b binding protein 8, chloroplastic (CAB8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
CAB8; LHCB1; Chlorophyll a-b binding protein 8, chloroplastic; LHCII type I CAB-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
37-268
Protein Length
Full Length of Mature Protein
Species
Pisum sativum (Garden pea)
Target Names
CAB8
Target Protein Sequence
RKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSK NRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK
Uniprot No.

Target Background

Function
The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems. It may also facilitate proton translocation from the catalytic manganese center of water oxidation into the thylakoid lumen.
Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How can recombinant CAB8 be effectively expressed and purified for structural studies?

    The process of expressing and purifying recombinant CAB8 for structural studies involves several critical methodological steps:

    a) Expression System Selection: For membrane proteins like CAB8, expression systems must be carefully chosen. While E. coli systems are common for many proteins, eukaryotic expression systems may be more suitable for properly folded CAB8 with correct post-translational modifications.

    b) Optimization Parameters: Key parameters to optimize include:

    • Induction temperature (typically lower temperatures of 16-20°C improve membrane protein folding)

    • Induction duration

    • Detergent selection for membrane protein extraction

    • Buffer composition during purification

    c) Purification Strategy: A multi-step purification approach is recommended:

    • Initial extraction with mild detergents (e.g., n-dodecyl β-D-maltoside)

    • Affinity chromatography using engineered tags

    • Size exclusion chromatography for final purification

    • All steps performed under green safe light or darkness to preserve chlorophyll integrity

    d) Quality Control Measures: Assess protein quality using:

    • SDS-PAGE and western blotting for purity and identity

    • Absorption spectroscopy to confirm chlorophyll binding

    • Circular dichroism to evaluate secondary structure

    • Dynamic light scattering to verify homogeneity

  • How can researchers address contradictions in CAB8-related research findings?

    Addressing contradictions in research findings related to CAB8 requires systematic approaches to contradiction detection and resolution:

    a) Contradiction Detection Framework: Implement a clinical contradiction detection approach as detailed in recent research . This involves:

    • Leveraging plant biology ontologies to identify potential contradictions

    • Using distant supervision to build a dataset of potentially contradictory statements

    • Applying machine learning models to identify contradictory claims in literature

    b) Analyzing Source Variables: When contradictory findings emerge, systematically evaluate:

    • Experimental design differences

    • Environmental conditions

    • Species/ecotype variations

    • Methodological differences in protein isolation and analysis

    • Statistical approaches used

    c) Research Gap Analysis: Apply the "Disagreement Gap" approach to identify balanced sets of opposing findings that warrant further investigation . This helps distinguish between genuine scientific contradictions versus methodological differences.

    d) Building Contradiction Datasets: Create datasets of model-generated contradictory statements about CAB8 to train detection systems that can help researchers identify patterns of contradiction in the literature .

    Table 1: Common sources of contradictions in CAB8 research and resolution approaches

    Contradiction SourceExampleResolution Approach
    Methodological differencesVarying protein extraction protocolsStandardize extraction methods or perform comparative studies
    Environmental variationsDifferent light conditions during growthExplicitly report and control environmental parameters
    Genetic diversityDifferent Pisum sativum varietiesUse recombinant inbred lines (RILs) to control genetic background
    Measurement techniquesDifferent spectroscopic methodsCross-validate with multiple techniques
  • What spectroscopic techniques are most informative for studying CAB8-chlorophyll interactions?

    Several spectroscopic methods provide complementary insights into CAB8-chlorophyll interactions:

    a) Low-Temperature Fluorescence Emission Spectroscopy: This technique, as employed in studies of pea epicotyls , allows for differentiation between different forms of chlorophyll based on their emission maxima. When applied to CAB8:

    • Samples are cooled to very low temperatures (typically 77K using liquid nitrogen)

    • Excitation at specific wavelengths reveals the emission spectra of bound chlorophyll molecules

    • Different peaks (e.g., at 629, 636, 650, and 681 nm) represent different chlorophyll forms and binding states

    b) Absorption Spectroscopy: Provides information about:

    • Chlorophyll a/b ratios in purified CAB8

    • Changes in absorption properties upon protein binding

    • Quantitative assessment of pigment content

    c) Circular Dichroism (CD) Spectroscopy: Reveals:

    • Secondary structure elements of CAB8

    • Pigment-protein interactions that create excitonic coupling

    • Conformational changes upon chlorophyll binding

    d) Time-Resolved Fluorescence Spectroscopy: Enables:

    • Measurement of energy transfer rates between chlorophyll molecules

    • Determination of excited state lifetimes

    • Assessment of energy transfer efficiency within CAB8

  • What are the key considerations for using recombinant inbred lines (RILs) in CAB8 research?

    RILs can serve as powerful tools for genetic mapping of traits related to CAB8 function . Key methodological considerations include:

    a) RIL Development Strategy:

    • Cross two inbred pea lines with different CAB8 variants or photosynthetic efficiencies

    • Conduct repeated selfing or sibling mating (typically 6-8 generations)

    • Genotype the resulting lines to confirm genetic mosaic structure

    b) Experimental Applications:

    • QTL mapping of photosynthetic efficiency traits

    • Association studies between CAB8 variants and photosynthetic performance

    • Studying epistatic interactions between CAB8 and other photosynthetic genes

    c) Statistical Analysis:

    • Account for map expansion in RILs (increased genetic distances due to accumulated recombination)

    • Consider clustering of breakpoints when analyzing genetic data

    • Apply appropriate genetic models for eight-way RILs if using complex crossing schemes

    d) Verification Methods:

    • Molecular markers to confirm RIL genotypes

    • Phenotypic assays to validate photosynthetic traits

    • Genomic sequencing to precisely characterize genetic composition

  • How can research questions about CAB8 be effectively formulated to address research gaps?

    Developing clear, concise, and open-ended research questions is fundamental to addressing gaps in CAB8 research :

    a) Research Question Formulation:

    • Transform broad topics (e.g., "CAB8 and stress response") into specific questions (e.g., "How does high light stress affect the expression and function of CAB8 in Pisum sativum?")

    • Ensure questions are clear, concise, and open-ended

    • Avoid questions that assume outcomes (e.g., "How does CAB8 improve photosynthetic efficiency?" assumes an improvement)

    b) Research Gap Identification:

    • Knowledge gaps: Areas where information about CAB8 is entirely missing

    • Methodological gaps: Lack of techniques to study specific aspects of CAB8

    • Contradictory findings: Areas where existing research shows inconsistent results

    • Contextual gaps: Lack of CAB8 research in specific environmental contexts

    c) Examples of Well-Formulated CAB8 Research Questions:

    • "What structural features of CAB8 determine its binding specificity for chlorophyll a versus chlorophyll b?"

    • "How does the expression pattern of CAB8 change throughout the development of Pisum sativum chloroplasts?"

    • "What is the role of CAB8 in non-photochemical quenching mechanisms under high light stress?"

    • "How do post-translational modifications affect CAB8 stability and function in the thylakoid membrane?"

  • What crystallization approaches are most successful for structural studies of CAB8?

    Building on the successful crystallization of the PSI-LHCI supercomplex from Pisum sativum , researchers should consider:

    a) Pre-crystallization Considerations:

    • Protein purity: Achieve >95% homogeneity using multi-step purification

    • Stability optimization: Screen buffers, detergents, and additives to maximize protein stability

    • Initial characterization: Use dynamic light scattering to confirm monodispersity

    b) Crystallization Strategy:

    • Detergent screening: Test various detergents compatible with membrane protein crystallization

    • Lipid cubic phase method: Consider for improved membrane protein crystal formation

    • Vapor diffusion techniques: Both hanging drop and sitting drop approaches

    • Automated screening: Use high-throughput methods to test hundreds of crystallization conditions

    c) Crystal Optimization:

    • Fine-tune promising conditions by varying:

      • Protein concentration

      • Precipitant concentration

      • pH

      • Temperature

      • Additive concentration

    • Implement seeding techniques to improve crystal size and quality

    d) Data Collection Considerations:

    • Use synchrotron radiation for high-resolution diffraction data

    • Consider micro-focus beamlines for small crystals

    • Implement strategies to minimize radiation damage to chlorophyll molecules

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.