Recombinant Pisum sativum Chlorophyll a-b binding protein AB80, chloroplastic (AB80)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
AB80; Chlorophyll a-b binding protein AB80, chloroplastic; LHCII type I CAB-AB80; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
38-269
Protein Length
Full Length of Mature Protein
Species
Pisum sativum (Garden pea)
Target Names
AB80
Target Protein Sequence
RKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSK NRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK
Uniprot No.

Target Background

Function

Function: The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems. It may also facilitate proton channeling from the catalytic manganese center of water oxidation into the thylakoid lumen.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Pisum sativum Chlorophyll a-b binding protein AB80 and what is its biological role?

AB80 (also known as Lhcb1*2) is a chlorophyll a/b-binding protein found in the light-harvesting complex II (LHC-II) of photosystem II in pea (Pisum sativum). This protein belongs to the Cab gene family and functions primarily in capturing light energy and transferring it to the photosynthetic reaction centers. AB80 is a Type I LHCII protein that binds both chlorophyll a and b molecules along with carotenoids, forming a pigment-protein complex essential for light harvesting in chloroplasts . The protein is encoded by one of several Cab genes in the pea genome and is part of a multigene family with differential expression patterns.

The biological significance of AB80 extends beyond basic light harvesting, as it plays roles in photoprotection, energy dissipation during high light conditions, and the structural organization of thylakoid membranes. The protein contains three transmembrane helices that anchor it in the thylakoid membrane, with specific binding sites for various pigment molecules. Research has shown that AB80 contributes to the dynamic response of the photosynthetic apparatus to changing light conditions, making it crucial for plant adaptation to variable environments .

How is recombinant AB80 protein typically produced for research purposes?

Production of recombinant AB80 typically involves a multi-step process beginning with gene cloning. Researchers often use the AB80 gene from pea (Pisum sativum) as a template, which can be modified as needed (e.g., replacing the single cysteine at position 79 with serine for certain applications) . The gene is then inserted into an expression vector with an appropriate promoter (often the T7 promoter for bacterial expression systems). Expression hosts commonly include E. coli strains optimized for recombinant protein production, though eukaryotic expression systems might be used for certain applications requiring post-translational modifications.

The expression protocol typically involves the following steps:

  • Transformation of the expression vector into the bacterial host

  • Culture growth to optimal density (usually mid-log phase)

  • Induction of protein expression (commonly with IPTG for T7-based systems)

  • Cell harvesting and lysis to release the expressed protein

  • Purification using affinity chromatography (often with His-tags)

  • Additional purification steps such as ion exchange or size exclusion chromatography

For functional studies, the purified apoprotein must be reconstituted with its pigments (chlorophylls and carotenoids) in detergent solution to form the complete light-harvesting complex. This reconstitution process involves mixing the denatured apoprotein (often in dodecyl sulfate) with isolated pigments under controlled conditions that allow proper folding and pigment binding . The successful reconstitution can be verified by spectroscopic methods that confirm the characteristic absorption and fluorescence properties of the native complex.

What experimental techniques are used to verify the structural integrity of recombinant AB80?

Multiple complementary techniques are employed to verify both the primary structure and functional folding of recombinant AB80 protein. Initial verification typically begins with SDS-PAGE to confirm the expected molecular weight (approximately 30 kDa for the mature protein) followed by Western blotting using specific antibodies against the AB80 protein . Mass spectrometry provides precise mass determination and can verify the amino acid sequence through peptide fingerprinting. Circular dichroism (CD) spectroscopy is essential for examining secondary structure elements, particularly the alpha-helical content that is characteristic of light-harvesting proteins.

For assessing the proper folding and pigment association of reconstituted AB80, absorption and fluorescence spectroscopy are indispensable tools. The properly folded and pigment-associated protein exhibits characteristic absorption peaks at approximately 440 nm and 670-680 nm from chlorophyll a, and 470 nm and 650 nm from chlorophyll b. Fluorescence emission spectra (typically with excitation at 440 nm) should show the characteristic peaks at around 680-685 nm, indicating proper energy transfer between pigments. The thermal stability of the reconstituted complex can be assessed using differential scanning calorimetry or temperature-dependent CD spectroscopy.

Advanced structural characterization may include:

TechniqueInformation ProvidedResolution
X-ray crystallographyDetailed 3D structureAtomic resolution (when successful)
Cryo-electron microscopy3D structure in near-native stateNear-atomic resolution (3-5 Å)
NMR spectroscopyDynamic structural informationAtomic resolution for smaller constructs
EPR spectroscopyLocal structural information, distances between spin labelsSite-specific information
Hydrogen-deuterium exchangeSolvent accessibility, conformational dynamicsPeptide-level resolution

Research has shown that pulse EPR techniques, particularly double-electron-electron resonance (DEER), can be especially valuable for analyzing protein folding during reconstitution by measuring distances between site-specifically introduced nitroxide spin labels .

How does AB80 gene expression respond to light and developmental cues?

The expression of the AB80 gene in Pisum sativum exhibits distinct patterns in response to both light conditions and developmental stages. Research has revealed that AB80 belongs to a specific subgroup of Type I LHCII genes (including AB80, AB66, and Cab-9) that shows different expression characteristics compared to other Cab genes . This subgroup displays little or no transcript accumulation 24 hours after a red light pulse, contrasting with other Cab genes (Cab-8, AB96, Cab-215, and Cab-315) that show relatively strong responses to red light.

Developmentally, the AB80 subgroup shows higher transcript levels in mature leaves compared to young buds, whereas genes in the other group have similar or slightly higher expression in buds compared to leaves . This distinct expression pattern suggests functional specialization within the Cab gene family. The transcript abundance of AB80 and related genes appears to be lower than those of the first group across all developmental conditions examined, indicating potential differences in their relative contributions to the light-harvesting apparatus.

The regulation of AB80 expression involves multiple factors:

  • Light quality and intensity: Red light is less effective at inducing AB80 expression compared to other Cab genes

  • Developmental stage: Higher expression in mature photosynthetic tissues than in developing tissues

  • Circadian rhythms: Like many photosynthesis-related genes, expression follows diurnal patterns

  • Chloroplast signaling: Retrograde signaling from the chloroplast affects nuclear gene expression

Studies have shown that treatments affecting chloroplast function, such as norflurazon (a carotenoid biosynthesis inhibitor) and photobleaching, can alter the expression responses of nuclear-encoded Cab genes, including AB80 . This demonstrates the complex integration of developmental, environmental, and organellar signals in regulating photosynthetic gene expression.

What are the current methodologies for studying protein-pigment interactions in recombinant AB80?

Investigating protein-pigment interactions in AB80 requires sophisticated approaches that combine biochemical, biophysical, and spectroscopic techniques. One fundamental strategy involves the selective extraction and reconstitution of pigments to determine binding specificity and affinity. Researchers can extract native chlorophylls and carotenoids from plant material using organic solvents, followed by HPLC purification to obtain individual pigment species. These purified pigments can then be systematically reintroduced to recombinant AB80 apoprotein under controlled conditions to assess binding preferences.

Site-directed mutagenesis provides another powerful approach by enabling the modification of specific amino acid residues predicted to interact with pigments. By replacing these residues and measuring the effects on pigment binding and protein stability, researchers can map the precise interactions governing the assembly of the light-harvesting complex. This approach has revealed critical chlorophyll-binding residues within the transmembrane helices of AB80 and related proteins. Typical experimental workflows combine mutagenesis with spectroscopic analyses to quantify changes in pigment binding and energy transfer efficiency.

Advanced spectroscopic techniques have proven particularly valuable for characterizing protein-pigment interactions with high resolution. These include:

  • Time-resolved fluorescence spectroscopy to measure energy transfer kinetics between chlorophylls

  • Resonance Raman spectroscopy to probe the vibrational properties of bound pigments

  • Transient absorption spectroscopy to track energy transfer pathways with femtosecond resolution

  • Linear and circular dichroism to assess pigment orientation within the protein scaffold

  • Magnetic resonance techniques (NMR, EPR) to investigate local electronic environments around pigments

Recent research has employed solid-state NMR in combination with selectively labeled chlorophylls to determine their precise orientation and interactions within the protein complex. Additionally, computational approaches such as molecular dynamics simulations and quantum mechanical calculations have become increasingly important for interpreting experimental data and predicting protein-pigment interactions based on structural models . These integrated approaches allow researchers to understand how the protein environment modulates pigment properties to optimize light harvesting and energy transfer efficiency.

How can researchers distinguish AB80 from other members of the Cab gene family in experimental settings?

Distinguishing AB80 from other highly similar Cab family members requires a combination of molecular, biochemical, and immunological approaches. The Cab gene family in Pisum sativum consists of at least seven identified genes with high sequence similarity, presenting significant challenges for specific detection and characterization . At the DNA and RNA levels, researchers have developed gene-specific PCR primers targeting unique regions within the coding or untranslated regions of AB80. This approach requires careful primer design based on sequence alignments to identify regions that differ sufficiently from other family members.

For quantitative expression analysis, researchers have employed a system using cDNA synthesis followed by PCR and chemiluminescence detection specifically optimized for individual Cab gene family members . This approach allows for accurate measurement of transcript levels for AB80 independently from other related genes. The method involves:

  • Isolation of high-quality RNA from the tissue of interest

  • Reverse transcription using gene-specific or oligo-dT primers

  • PCR amplification with primers targeting unique regions of AB80

  • Detection and quantification using chemiluminescence-based methods

  • Validation of specificity through sequencing of amplification products

At the protein level, distinguishing AB80 requires more sophisticated approaches due to the high sequence similarity among LHCII proteins. Monoclonal antibodies have been developed that can differentiate between specific LHCII polypeptides based on subtle epitope differences . These antibodies have been instrumental in determining the relative abundance of different LHCII proteins in thylakoid membranes. Research has shown that antibodies can be generated that specifically recognize the 26-kDa polypeptide (27 copies per 400 chlorophylls) versus the 28-kDa polypeptide (2 copies per 400 chlorophylls) in pea thylakoids .

Mass spectrometry-based proteomics represents the most powerful contemporary approach for distinguishing closely related proteins. Techniques such as:

TechniqueApplication to AB80Key Advantage
Liquid chromatography-tandem MS (LC-MS/MS)Identification of unique peptidesHigh sensitivity and specificity
Selected reaction monitoring (SRM)Quantification of AB80-specific peptidesTargeted quantification in complex samples
Top-down proteomicsAnalysis of intact proteinPreserves post-translational modifications
Hydrogen-deuterium exchange MSStructural analysisProbes protein dynamics and interactions

What are the current challenges in expressing and purifying functional recombinant AB80?

Production of functional recombinant AB80 presents several significant challenges that researchers must overcome. The protein's membrane-associated nature constitutes the primary obstacle, as it contains multiple transmembrane domains that make it prone to misfolding and aggregation when expressed in heterologous systems. Expression in bacterial systems like E. coli often results in inclusion body formation, necessitating denaturation and refolding protocols that may compromise functional integrity. Additionally, the protein requires proper interaction with chlorophyll and carotenoid pigments for complete structural integrity and function, components not naturally present in bacterial expression systems.

The reconstitution process requires careful optimization of multiple parameters to achieve proper folding and pigment integration. Researchers must consider detergent selection, lipid composition, pigment ratios, and buffer conditions, all of which can significantly impact reconstitution efficiency. The procedure typically involves:

  • Solubilization of purified apoprotein in an appropriate detergent

  • Addition of purified pigments at optimized ratios and concentrations

  • Controlled removal of denaturing agents to allow protein folding

  • Buffer exchange to stabilize the reconstituted complex

  • Verification of structural integrity and pigment binding

Post-translational modifications represent another significant challenge, as plant-specific modifications may be absent in bacterial expression systems. Recent approaches have explored eukaryotic expression systems including yeast, insect cells, and plant-based systems to address this limitation. Additionally, the presence of numerous disulfide bonds and potential phosphorylation sites in the native protein requires careful consideration of redox conditions and kinase activities during expression and purification . Research has shown that phosphorylation by stromal kinases, possibly including casein kinase II, may regulate AB80 function in vivo, adding another layer of complexity to producing functionally authentic recombinant protein .

How is AB80 localized and assembled within the chloroplast membrane system?

The biogenesis and membrane integration of AB80 involves a complex, multi-step process beginning with cytosolic synthesis and culminating in precise localization within thylakoid membranes. AB80 is nuclear-encoded and synthesized as a preprotein with an N-terminal chloroplast transit peptide that directs it to the chloroplast. Import experiments have demonstrated that the AB80 preprotein (approximately 35 kDa) is efficiently transported into isolated chloroplasts and processed to its mature form (approximately 30 kDa) by stromal processing peptidases . Following import, the protein must be correctly targeted to its final destination in the thylakoid membrane, where it associates with other LHCII components and incorporates chlorophyll and carotenoid pigments.

Research using fluorescent protein fusion constructs has provided valuable insights into the spatial organization of AB80 within chloroplasts. When expressed as a CFP fusion protein in Nicotiana benthamiana leaves, AB80 localizes to punctate structures that correspond to plastoglobules (PGs), specialized lipid droplets within chloroplasts . Colocalization experiments with established PG markers such as Fibrillin1A (FBN1A) confirm this association. Sucrose gradient ultracentrifugation of chloroplast membranes further corroborates these findings, showing that AB80 cofractionates with known PG proteins like Fibrillin2 (FBN2) in the lowest density fractions .

The assembly of AB80 into functional LHCII complexes requires coordination with chlorophyll biosynthesis and the chloroplast protein insertion machinery. The process follows this general sequence:

  • Import of preprotein into the chloroplast stroma

  • Removal of the transit peptide to form the mature protein

  • Association with chaperones that prevent aggregation

  • Targeting to thylakoid membranes via the cpSRP pathway

  • Membrane insertion facilitated by ALB3 translocase

  • Association with newly synthesized chlorophyll molecules

  • Assembly into trimeric LHCII complexes

  • Integration into photosystem II supercomplexes

The spatial distribution of AB80 within thylakoid membranes is not uniform. Studies using immunogold electron microscopy have revealed enrichment in the appressed regions of thylakoid membranes (grana), where photosystem II predominantly resides. This specific localization is crucial for the protein's light-harvesting function and its contribution to the macromolecular organization of the photosynthetic apparatus .

What methodologies are used to study AB80 interaction with heme and other tetrapyrroles?

Although AB80 primarily binds chlorophylls, recent research has uncovered interesting interactions with other tetrapyrroles, particularly heme, which may have regulatory implications. Investigating these interactions requires specialized methodologies that can detect and characterize specific binding events. One fundamental approach involves hemin-agarose binding assays, where purified recombinant protein is incubated with hemin-agarose resin, followed by extensive washing and elution of bound protein. Specificity can be verified through competition assays using free hemin to block binding sites before exposure to the hemin-agarose . This approach has successfully demonstrated heme-binding capability in several plant proteins including SOUL4, which shares structural features with AB80.

Spectroscopic techniques provide more detailed information about the nature of tetrapyrrole interactions. UV-visible absorption spectroscopy can detect characteristic shifts in the Soret band (around 400 nm) and Q bands (500-600 nm) of heme upon protein binding. Similarly, changes in the absorption spectra of chlorophylls when bound to AB80 provide information about the electronic environment created by the protein scaffold. Fluorescence spectroscopy offers additional insights, particularly through fluorescence quenching experiments where heme or other tetrapyrroles may quench the intrinsic fluorescence of aromatic amino acids in the protein, allowing determination of binding affinity and stoichiometry.

More sophisticated biophysical approaches include:

  • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

  • Surface plasmon resonance (SPR) to assess binding kinetics

  • Resonance Raman spectroscopy to probe vibrational modes of bound tetrapyrroles

  • Electron paramagnetic resonance (EPR) to characterize the electronic state of the iron center in heme

  • X-ray absorption spectroscopy for detailed electronic structure analysis

Research on related proteins has revealed that tetrapyrrole binding can be regulated by post-translational modifications, particularly phosphorylation . In vitro phosphorylation assays using purified kinases or stromal extracts have demonstrated that proteins like SOUL4 can be phosphorylated by chloroplastic casein kinase II, potentially regulating their tetrapyrrole-binding properties. This suggests a potential regulatory mechanism that may also apply to AB80 and its interactions with various tetrapyrroles in the chloroplast environment.

How can AB80 be used as a model for studying membrane protein folding and dynamics?

AB80 represents an excellent model system for investigating the fundamental principles governing membrane protein folding and dynamics due to several advantageous properties. The protein can be expressed recombinantly, purified in denatured form, and subsequently refolded in vitro upon addition of its natural ligands (chlorophylls and carotenoids), enabling detailed studies of the folding pathway . This unique property allows researchers to initiate folding from a defined starting state and monitor the process in real-time using various biophysical techniques. Additionally, the relatively small size of AB80 compared to many other membrane proteins facilitates structural and spectroscopic analyses.

Research has demonstrated that the denatured AB80 apoprotein, when mixed with its pigments in detergent solution, spontaneously folds into a structurally authentic light-harvesting complex within minutes . This self-organization process provides an exceptional opportunity to study protein-ligand interactions that drive membrane protein folding. The availability of high-resolution crystal structures for LHCII complexes further enhances the value of AB80 as a model system by providing a structural framework for interpreting experimental results.

Pulse EPR techniques, particularly double-electron-electron resonance (DEER), have proven especially valuable for analyzing protein folding dynamics. By introducing pairs of nitroxide spin labels at specific positions within the protein sequence, researchers can measure distance distributions between these labels at various time points during the folding process . This approach has been successfully applied to monitor the folding of specific structural elements in AB80, such as:

Structural ElementSpin Label PositionsKey Findings
Transmembrane helix 3Both ends of the helixRapid formation during early folding stages
Helices 1 and 4Near luminal endsLater consolidation of tertiary structure
Loop regionsVarious positionsHigh flexibility throughout folding process

The methodology typically involves:

  • Site-directed mutagenesis to introduce cysteine residues at specific positions

  • Selective labeling with nitroxide spin probes

  • Denaturation of the labeled protein

  • Initiation of refolding by adding pigments

  • Collection of EPR data at defined time points

  • Analysis of distance distributions to track structural changes

This approach provides unique insights into the folding pathway that are difficult to obtain with other techniques, particularly for membrane proteins. Additional techniques such as hydrogen-deuterium exchange mass spectrometry, single-molecule fluorescence, and cryo-electron microscopy can complement these studies to provide a comprehensive view of AB80 folding dynamics. These methodologies collectively make AB80 an invaluable model for understanding the principles of membrane protein folding, with potential implications for protein engineering and the development of membrane protein expression systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.