Recombinant Pisum sativum Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Structure and Function of cemA

  • Native Role: cemA is a chloroplast envelope membrane protein involved in maintaining chloroplast integrity and regulating metabolite transport across membranes . In P. sativum, it is encoded by the cemA gene (synonyms: ycf10), which is conserved across plant species .

  • Sequence Features: The cemA protein typically contains 229 amino acids with a molecular weight of ~26 kDa. Its sequence includes transmembrane domains critical for membrane anchoring and a C-terminal region implicated in protein-protein interactions .

Recombinant Production and Characterization

Recombinant cemA is produced via heterologous expression systems to study its biochemical properties. Key findings include:

Expression Systems

Host SystemTagPurityYieldSource
E. coliN-terminal His>90%63 mg/LBarbarea verna
BaculovirusUndisclosed>85%Not reportedCyanidium caldarium
  • Optimized Protocols: Buffered basal salt media and codon-optimized vectors enhance solubility and yield .

  • Post-Translational Modifications: Recombinant cemA retains structural fidelity compared to native forms, confirmed by circular dichroism and mass spectrometry .

Functional Insights from Related Studies

  • Membrane Localization: Proteomic analyses of P. sativum chloroplast envelopes identified cemA as a low-abundance integral membrane protein, suggesting specialized roles in metabolite transport or stress responses .

  • Interactome: cemA co-purifies with stromal proteins like RuBisCO subunits, hinting at cross-compartment coordination .

  • Antifungal Activity: Recombinant plant defensins (e.g., Psd1 in P. sativum) share expression challenges with cemA, underscoring the importance of proper folding for functionality .

Applications and Challenges

  • Biotechnological Potential: Recombinant cemA could aid in engineering chloroplast membranes for enhanced stress tolerance or metabolic engineering .

  • Limitations: Low native abundance and membrane localization complicate purification. Contamination by stromal proteins (e.g., RuBisCO) is common during extraction .

Genomic Context in Pisum sativum

  • The cemA gene resides on chromosome 5 in P. sativum, as per the pea reference genome .

  • Regulatory motifs upstream of cemA suggest developmental and environmental modulation, though functional validation is pending .

Comparative Analysis with Other Species

FeatureP. sativumBarbarea vernaCyanidium caldarium
AA Length229 (predicted)229Partial (Uniprot: Q9TM16)
Expression HostNot reportedE. coliBaculovirus
Structural DataNMR (indirect) CD/NMR Not available

Future Directions

  • Cryo-EM Studies: High-resolution structural analysis could elucidate cemA’s role in chloroplast transport mechanisms.

  • Metabolic Engineering: Overexpression in transplastomic plants may clarify its impact on chloroplast function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
cemA; hbp; ycf10; Chloroplast envelope membrane protein; Heme-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Pisum sativum (Garden pea)
Target Names
cemA
Target Protein Sequence
MAKKKAFIPLLCLTSIVFLPWCISFTFKKSLESWITHWYNTKESEIFLNTIQEKSILKKF LEFEELFLLDEMLKEYPETRLQNLRIEIYKETIQLIQTNNQDHIHTILHFCTNIICFLIL SVYSIRGNQELIILNSWVQEFLYNLSDTIKAFSILFLIEFCVGYHSTGGWELMIGSVYKD FGFIPNDHIISFLVSILPAILDTIFKYWIFRYLNRVSPSLVLIYDSIPFQE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the cemA protein and what is its role in chloroplast function?

The cemA (chloroplast envelope membrane protein A) is a membrane-bound protein located in the chloroplast envelope of Pisum sativum (garden pea). It plays crucial roles in chloroplast membrane organization and function. Like other envelope membrane proteins, cemA contributes to maintaining the structural integrity of chloroplasts and facilitates molecular transport across the envelope membranes. Research indicates that chloroplast envelope membranes contain distinct polypeptide compositions, with specific proteins localized to either the inner or outer membrane, creating functional specialization .

What techniques are most effective for isolating chloroplast envelope membranes from Pisum sativum?

For effective isolation of chloroplast envelope membranes from Pisum sativum (var. Laxtons Progress No. 9 or similar varieties), researchers typically employ differential centrifugation followed by sucrose gradient separation. The method involves:

  • Tissue homogenization in isotonic buffer

  • Filtration to remove debris

  • Low-speed centrifugation to pellet intact chloroplasts

  • Osmotic shock to release envelope membranes

  • Sucrose gradient ultracentrifugation to separate inner and outer membranes

This methodology allows separation of the two membrane fractions with distinct polypeptide compositions for further analysis, while minimizing contamination with stromal proteins . Researchers should verify membrane fraction purity using marker enzymes specific to inner or outer membranes.

What expression systems are suitable for recombinant production of Pisum sativum chloroplast proteins?

Based on successful recombinant expression of other Pisum sativum proteins, Escherichia coli remains one of the most effective expression systems for chloroplast envelope membrane proteins. The bacterial expression approach involves:

  • cDNA attachment to an inducible promoter (e.g., T7 or lac)

  • Transformation into appropriate E. coli expression strains

  • Growth under controlled conditions

  • Induction of protein expression

  • Purification via affinity chromatography

Particularly for membrane proteins, specialized E. coli strains designed for membrane protein expression may be required. Addition of an N-terminal histidine tag facilitates purification while maintaining protein functionality, as demonstrated with other recombinant Pisum sativum proteins .

What electrophoretic methods best differentiate between inner and outer chloroplast envelope membrane proteins?

Two-dimensional gel electrophoresis has proven particularly effective for distinguishing between proteins from inner and outer chloroplast envelope membranes. The methodology involves:

  • First dimension: Isoelectric focusing separation based on protein charge

  • Second dimension: SDS-PAGE separation based on molecular weight

  • Visualization with protein-specific staining methods

This technique has successfully demonstrated that certain polypeptides that co-migrate in one-dimensional SDS-PAGE (appearing to have identical molecular weights) are actually distinct proteins with different isoelectric points. For example, an 86-kilodalton band present in both membrane fractions was revealed by 2D electrophoresis to represent at least two different polypeptides - one specific to the outer membrane and another to the inner membrane .

How can researchers confirm the identity and purity of recombinant cemA protein?

Multiple complementary analytical techniques should be employed to verify recombinant cemA identity and purity:

Analytical MethodPurposeTypical Results
Western blottingIdentity confirmationSpecific band at expected molecular weight
ELISAQuantification and epitope presenceBinding curve with appropriate antibodies
Mass spectrometryPrecise mass determination and peptide mappingMatches to theoretical mass and sequence
Circular dichroismSecondary structure analysisCharacteristic spectra for protein fold
Size exclusion chromatographyOligomerization state analysisElution volume indicating native state

For recombinant proteins from Pisum sativum expressed in E. coli, researchers should also verify functional properties using activity assays specific to the protein of interest. Techniques such as ELISA and Western blotting have been successfully applied to confirm the identity of recombinant Pisum sativum proteins .

What crystallization conditions have been successful for structural studies of Pisum sativum chloroplast proteins?

Crystallization of Pisum sativum proteins has been achieved under the following conditions:

  • Protein concentration: 5-10 mg/mL in appropriate buffer systems

  • Crystal formation technique: Hanging drop vapor diffusion

  • Temperature: 16-20°C

  • Precipitant solutions: Typically containing polyethylene glycol or ammonium sulfate

  • Additives: Divalent cations (Ca²⁺, Mg²⁺) and specific ligands

For recombinant propeptide lectin from Pisum sativum, crystals have been successfully obtained in space group P2₁2₁2₁ with unit cell dimensions a = 64.8 Å, b = 73.8 Å, and c = 109.0 Å that diffract to 2.8 Å resolution . Similar conditions may serve as starting points for crystallization trials with recombinant cemA protein, though membrane proteins typically require detergent screening for successful crystallization.

How does the structural organization of recombinant cemA compare with native protein in Pisum sativum chloroplasts?

When comparing recombinant and native chloroplast envelope membrane proteins, researchers should evaluate several structural parameters:

  • Secondary and tertiary structure via circular dichroism and limited proteolysis

  • Oligomerization state via size exclusion chromatography and native PAGE

  • Lipid interactions via reconstitution experiments

  • Post-translational modifications via mass spectrometry

  • X-ray crystallography or cryo-EM for high-resolution structure comparison

Evidence from other Pisum sativum proteins suggests that recombinant proteins expressed in E. coli can maintain structures virtually identical to their native counterparts. For instance, the recombinant propeptide form of the lectin from garden pea produced crystals with unit cell dimensions similar to those of the native protein, indicating structural conservation despite expression in a prokaryotic system . For cemA, researchers should specifically investigate membrane integration patterns and protein-lipid interactions to confirm structural fidelity.

What strategies can overcome problems with expression of insoluble or improperly folded recombinant cemA?

Membrane proteins like cemA often present challenges in recombinant expression systems. Several strategies can improve expression outcomes:

ChallengeSolution StrategyImplementation Details
InsolubilityFusion partnersAddition of solubility-enhancing tags (MBP, SUMO, thioredoxin)
Toxicity to hostTight expression controlUse of tightly regulated promoters with minimal leaky expression
Improper foldingChaperone co-expressionCo-transformation with plasmids encoding folding machinery
Membrane integrationDetergent screeningSystematic testing of various detergents for extraction
Low yieldCodon optimizationAdaptation of codon usage to expression host
DegradationProtease-deficient strainsUse of E. coli strains lacking specific proteases

For chloroplast envelope membrane proteins from Pisum sativum, researchers have successfully used inducible promoters for controlled expression, producing functional proteins that retain native properties and can be properly analyzed by techniques such as crystallography .

What are the key differences between inner and outer chloroplast envelope membrane proteomes in Pisum sativum?

Analysis of Pisum sativum (var. Laxtons Progress No. 9) chloroplast envelope membranes reveals distinct proteome compositions between inner and outer membranes:

  • The inner and outer membranes possess unique protein profiles despite some apparently comigrating bands in SDS-PAGE

  • Two-dimensional electrophoresis shows that proteins of similar molecular weight may be completely different proteins in each membrane

  • An 86-kilodalton protein band represents at least two distinct polypeptides - one in the outer membrane and one in the inner membrane

  • Several polypeptide bands found in both membranes originate from stromal contamination, including the large and small subunits of ribulose 1,5-bisphosphate carboxylase

  • The association of stromal proteins with membrane fractions is surprisingly resistant to disruption by sonication and other treatments

These findings highlight the importance of using multiple analytical techniques beyond standard SDS-PAGE to accurately characterize membrane protein distribution, particularly when working with recombinant versions of these proteins.

How can researchers differentiate between genuine envelope membrane proteins and stromal contaminants?

Distinguishing true envelope membrane proteins from stromal contaminants requires a multi-faceted approach:

  • Two-dimensional gel electrophoresis to separate proteins by both molecular weight and isoelectric point

  • Immunological identification using specific antibodies via techniques like Western blotting and enzyme-linked immunosorbent assay

  • Comparison with purified stromal protein preparations

  • Resistance to extraction by various treatments (high salt, carbonate, detergents)

  • Protease protection assays to determine topology and membrane integration

Research with Pisum sativum chloroplasts demonstrates that some seemingly envelope-associated proteins (including ribulose 1,5-bisphosphate carboxylase large and small subunits) are actually stromal contaminants. Interestingly, these stromal proteins remain associated with membrane fractions even after treatments like sonication, suggesting they may have unexpected interactions with membrane components rather than simply being surface contaminants .

What post-translational modifications should be considered when analyzing recombinant versus native cemA protein?

When comparing recombinant and native cemA protein, researchers should investigate several potential post-translational modifications:

Modification TypeAnalysis MethodBiological Significance
Proteolytic processingN-terminal sequencing, mass spectrometryMaturation of propeptide form
PhosphorylationPhospho-specific staining, mass spectrometryRegulatory function
GlycosylationGlyco-staining, lectin affinity, mass spectrometryStability and recognition
Lipid modificationsSpecialized mass spectrometryMembrane anchoring
Disulfide bondsNon-reducing vs. reducing SDS-PAGEStructural integrity

Evidence from studies with other Pisum sativum proteins shows that recombinant propeptide forms can retain critical functional properties even before proteolytic processing that occurs in the native system. For instance, the propeptide form of lectin expressed in E. coli maintained properties including dimerization ability, hemagglutination titer, and immunological reactivity, suggesting similar post-translational behavior might be expected for recombinant cemA .

What techniques provide the most reliable quantification of cemA protein in mixed membrane preparations?

For accurate quantification of cemA in complex membrane preparations, researchers should employ multiple complementary techniques:

  • Quantitative Western blotting with purified recombinant cemA as a standard

  • ELISA with specific antibodies against cemA

  • Mass spectrometry-based quantification using:

    • Label-free quantification based on spectral counting

    • Stable isotope labeling approaches (SILAC, iTRAQ)

    • Selected reaction monitoring (SRM) with isotope-labeled peptide standards

  • Fluorescence-based quantification using specific antibodies or activity-based probes

Each method has strengths and limitations, so employing multiple approaches provides more reliable quantification. For chloroplast envelope membrane proteins from Pisum sativum, researchers have successfully used immunological techniques like Western blotting coupled with enzyme-linked immunosorbent assays to identify and quantify specific proteins .

How can the functional activity of recombinant cemA be assessed in vitro?

Assessing functional activity of recombinant cemA requires reconstitution of membrane environment and measurement of specific activities:

  • Reconstitution into liposomes or nanodiscs to provide membrane environment

  • Transport assays using fluorescent substrates or radiolabeled compounds

  • Measurement of ATPase activity if applicable

  • Protein-protein interaction studies with known binding partners

  • Structural changes in response to physiological conditions (pH, ion concentrations)

The specific assays will depend on the putative functions of cemA, which may include ion transport, metabolite transport, or signal transduction. For other recombinant Pisum sativum proteins, functionality has been confirmed through assays such as hemagglutination for lectins, demonstrating that recombinant proteins can maintain native activities when properly expressed and purified .

What protein-protein interaction networks involve cemA in chloroplast envelope membranes?

To identify protein-protein interaction networks involving cemA, researchers should employ multiple complementary approaches:

  • Co-immunoprecipitation with cemA-specific antibodies followed by mass spectrometry

  • Yeast two-hybrid screening using cemA as bait

  • Split-reporter protein complementation assays

  • Proximity labeling techniques (BioID, APEX) in transgenic plants

  • Cross-linking mass spectrometry to capture transient interactions

  • Blue native PAGE to identify native protein complexes

Analysis of chloroplast envelope membranes from Pisum sativum has revealed complex protein patterns with distinct compositions in inner and outer membranes . Understanding the protein-protein interaction landscape is essential for elucidating cemA function within these membrane systems.

How does the lipid composition of recombinant protein preparations affect cemA structural integrity and function?

The lipid environment significantly impacts membrane protein structure and function. For recombinant cemA, researchers should consider:

Lipid ParameterImpact on ProteinAssessment Method
Phospholipid compositionStructural stabilityCircular dichroism in various lipid environments
Membrane fluidityProtein mobility and functionFluorescence anisotropy measurements
Membrane thicknessHydrophobic matchingMolecular dynamics simulations
Lipid rafts/microdomainsLocalized functionDetergent resistance and super-resolution microscopy
Specific lipid interactionsAllosteric regulationNative mass spectrometry with bound lipids

When working with recombinant chloroplast membrane proteins, researchers should attempt to mimic the native lipid environment of chloroplast envelopes for optimal functional studies. The unique lipid composition of chloroplast membranes, which differs significantly from bacterial membranes, may be critical for proper cemA folding and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.