Recombinant Pisum sativum Cytochrome b6-f complex iron-sulfur subunit, chloroplastic (petC)

Shipped with Ice Packs
In Stock

Description

Protein Overview

The petC gene encodes the Rieske iron-sulfur subunit of the cytochrome b6-f complex, a critical component in the photosynthetic electron transport chain. This complex facilitates plastoquinol oxidation and plastocyanin reduction, driving proton gradient formation for ATP synthesis . Recombinant petC retains the functional properties of the native protein, including its [2Fe-2S] cluster essential for electron transfer .

Functional Role

  • Electron Transport: Mediates electron transfer between photosystem II and I via the Q-cycle mechanism .

  • Regulatory Interactions: Studies in Synechocystis suggest indirect regulatory roles in phycobilisome and photosystem stoichiometry .

Expression and Purification

  • Cloning: Full-length petC (51–230aa) is cloned into E. coli vectors with a His tag for affinity chromatography .

  • Yield: Typical yields range from 0.1–1.0 mg/mL post-reconstitution .

Research Applications

ApplicationDetails
SDS-PAGE AnalysisUsed to verify purity (>90%) and molecular weight (~21 kDa) .
Antibody DevelopmentAnti-PetC antibodies (e.g., Agrisera AS08 330) detect the protein in Western blots and BN-PAGE .
Enzyme Activity AssaysMeasures plastoquinol:plastocyanin oxidoreductase activity (EC 1.10.9.1) .

Research Findings

  • Cyanobacterial Studies: In Synechocystis, petC knockout mutants showed unchanged cytochrome b6-f activity but altered photosystem ratios, suggesting regulatory cross-talk .

  • Structural Studies: NMR and X-ray crystallography have resolved the Rieske domain’s role in electron transfer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
petC; Cytochrome b6-f complex iron-sulfur subunit, chloroplastic; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; Rieske iron-sulfur protein; ISP; RISP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
51-230
Protein Length
full length protein
Species
Pisum sativum (Garden pea)
Target Names
petC
Target Protein Sequence
ATSIPADRVPDMSKRKTLNLLLLGALSLPTAGMLVPYGSFLVPPGSGSSTGGTVAKDAVG NDVVATEWLKTHAPGDRTLTQGLKGDPTYLVVEKDRTLATFAINAVCTHLGCVVPFNQAE NKFICPCHGSQYNDQGRVVRGPAPLSLALAHCDVGVEDGKVVFVPWVETDFRTGDAPWWS
Uniprot No.

Target Background

Function

A component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does petC play in photosynthetic electron transfer?

The cytochrome b6-f complex serves as a critical orchestrator of photosynthetic electron transfer in plant chloroplasts. This complex displays strong similarity to the respiratory cytochrome bc1 complex found in mitochondria, with significant conservation of core redox components encased within a central four-helix bundle . The iron-sulfur subunit (petC), also known as the Rieske iron-sulfur protein (RISP), contains a characteristic 2Fe-2S cluster that is essential for electron transfer during photosynthesis .

Studies with mutants lacking functional petC have demonstrated that this protein is not only important for electron transfer but is essential for the assembly and stability of the entire cytochrome b6-f complex . The Lemna perpusilla mutant containing less than 1% of the normal protein subunits showed that when petC expression is reduced, other components of the complex display increased turnover rates, highlighting petC's key role in complex stability .

How does expressing recombinant petC differ from studying the native protein within the cytochrome b6-f complex?

Studying recombinant petC presents several important differences compared to investigating the native protein within its complex:

  • Structural context: In its native environment, petC functions as part of the dimeric cytochrome b6-f complex, interacting with multiple other subunits including cytochrome b6, cytochrome f, and subunit IV . When expressed recombinantly, petC lacks these stabilizing interactions, which may affect its structure and function.

  • Fe-S cluster assembly: The native protein has its Fe-S cluster assembled by the chloroplast Fe-S cluster assembly machinery. In heterologous expression systems like E. coli, the bacterial Fe-S assembly systems must correctly insert this cofactor, which may not always occur with full efficiency.

  • Post-translational processing: In plants, petC undergoes transit peptide cleavage before reaching its functional location. Recombinant systems may include artificial processing or express only the mature portion of the protein, as seen in the commercially available recombinant petC that includes only residues 51-230 .

  • Stability considerations: Research on a Lemna perpusilla mutant showed that reduced petC expression led to increased turnover rates for other components of the cytochrome b6-f complex . This suggests the stability of petC itself may be different when expressed alone rather than as part of the complete complex.

  • Functional assessment: Assessing the electron transfer function of isolated petC requires carefully designed in vitro systems with appropriate electron donors and acceptors, whereas the native protein operates within an organized electron transport chain with precisely positioned redox partners.

These differences highlight the importance of careful experimental design when working with recombinant petC, especially for researchers seeking to extrapolate findings to the behavior of the native protein in vivo.

What are the optimal strategies for expressing functional recombinant petC in heterologous systems?

Based on current literature and the successful expression of recombinant petC in E. coli , as well as insights from the expression of other plant proteins , the following strategies are recommended for optimal expression:

  • Expression system selection:

    • E. coli remains the most commonly used system for petC expression

    • Consider specialized E. coli strains designed for expression of proteins with disulfide bonds or Fe-S clusters

    • For certain applications requiring eukaryotic processing, Pichia pastoris may offer advantages, as demonstrated with other pea proteins

  • Expression vector design:

    • Include an appropriate N-terminal His-tag or other affinity tag for purification

    • Consider codon optimization for the host organism

    • For E. coli expression, T7 promoter-based systems typically provide high-level expression

    • Remove sequences encoding the transit peptide (amino acids 1-50) to express only the mature protein

  • Growth and induction conditions:

    • Optimize temperature (often lower temperatures of 18-25°C improve folding of complex proteins)

    • Determine optimal induction timing and inducer concentration

    • Consider supplementing growth media with iron sources to support Fe-S cluster formation

    • For labeled protein expression, optimize minimal media composition as demonstrated for other recombinant proteins, where yields of 63.0 mg/L have been achieved

  • Purification strategy:

    • Utilize immobilized metal affinity chromatography (IMAC) leveraging the His-tag

    • Follow with gel filtration to ensure homogeneity

    • Employ anaerobic techniques when possible to prevent oxidation of the Fe-S cluster

  • Protein stabilization:

    • Include appropriate storage buffers (e.g., Tris/PBS-based buffer with 6% Trehalose, pH 8.0)

    • Add glycerol (5-50%) for long-term storage

    • Aliquot to avoid repeated freeze-thaw cycles

ParameterOptions to TestNotes
Expression hostE. coli BL21(DE3), Rosetta, SHuffle; P. pastorisTest multiple strains for optimal expression
Induction temperature37°C, 30°C, 25°C, 18°CLower temperatures often improve folding
Media formulationLB, TB, Auto-induction, Minimal mediaDifferent media affect expression levels and protein quality
Inducer concentration0.1mM, 0.5mM, 1.0mM IPTG (for E. coli)Optimize for balance between yield and solubility
Purification strategyIMAC, ion exchange, gel filtrationMulti-step purification improves purity

How can researchers verify the integrity of the Fe-S cluster in recombinant petC?

The functional integrity of recombinant petC hinges on proper incorporation of the 2Fe-2S cluster. Several complementary methods can assess cluster integrity:

  • UV-Visible Spectroscopy:

    • The 2Fe-2S cluster in the Rieske protein exhibits characteristic absorption peaks

    • Compare spectra with published data for native cytochrome b6f complex

    • Monitor absorbance ratios between protein (280 nm) and Fe-S cluster peaks

    • Look for shifts in spectra upon reduction that indicate functional redox activity

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Provides detailed information about the redox state and environment of the Fe-S cluster

    • Can confirm the presence of a properly assembled 2Fe-2S cluster with the expected g-values

    • Requires reduced sample preparation and specialized equipment

    • Particularly valuable for distinguishing between different types of Fe-S clusters

  • Circular Dichroism (CD) Spectroscopy:

    • Can reveal information about both protein secondary structure and Fe-S cluster environment

    • Particularly useful in the visible region for Fe-S proteins

    • Allows monitoring of both protein folding and cofactor incorporation simultaneously

  • Redox Potential Measurements:

    • Determine if the recombinant protein has similar redox properties to the native protein

    • Can be measured using techniques such as potentiometric titrations

    • The cytochrome b6f complex has characteristic redox potentials as described in the literature

  • Functional Assays:

    • Electron transfer assays using appropriate electron donors and acceptors

    • Compare activity with published values for native protein

    • Can confirm not only the presence but also the functional capacity of the Fe-S cluster

  • Metal Content Analysis:

    • Inductively coupled plasma mass spectrometry (ICP-MS) to quantify iron content

    • Expected ratio of 2 iron atoms per petC molecule for properly assembled Fe-S cluster

    • Can also detect other metals that might have been incorrectly incorporated

The most robust approach combines multiple techniques, as each provides complementary information about different aspects of cluster integrity and protein functionality.

What experimental approaches can differentiate between native and recombinant petC in research applications?

Distinguishing between native and recombinant petC is essential for many experimental applications, particularly those investigating protein-protein interactions or in vivo localization. Several methodological approaches can effectively differentiate these forms:

  • Tag-Based Detection:

    • The recombinant petC typically includes an N-terminal His-tag or other affinity tag

    • Anti-His antibodies can specifically detect the recombinant protein in Western blots

    • His-tag-specific fluorescent probes can be used in microscopy for localization studies

    • Metal affinity techniques can selectively purify the His-tagged recombinant protein

  • Mass Spectrometry Approaches:

    • The recombinant protein has a different exact mass due to the tag and potential sequence differences

    • Peptide mapping can identify tag-derived peptides and sequence variations

    • Selected reaction monitoring (SRM) can be used to quantify specific peptides unique to each form

    • Comparison of post-translational modifications between recombinant and native forms

  • Electrophoretic Mobility:

    • The His-tagged recombinant protein will have a slightly higher molecular weight

    • High-resolution SDS-PAGE can potentially separate native and recombinant forms

    • 2D gel electrophoresis may reveal differences in isoelectric points

  • Immunological Methods:

    • Develop antibodies that specifically recognize the junction between the tag and protein

    • Use epitope-specific antibodies if the recombinant construct has any sequence differences

    • Dual-labeling approaches using both anti-petC and anti-tag antibodies

  • Expression System-Specific Modifications:

    • Look for E. coli-specific post-translational modifications or lack of plant-specific modifications

    • Compare glycosylation patterns if applicable (though not typically relevant for chloroplast proteins)

For quantitative studies comparing recombinant and native petC, it's advisable to develop calibration curves using known amounts of purified recombinant protein to accurately quantify native protein levels in plant samples.

What are the optimal buffer systems and storage conditions for maintaining recombinant petC stability?

The stability of recombinant petC, particularly with respect to its Fe-S cluster, requires careful attention to buffer composition and storage conditions. Based on information from search result and general principles for handling Fe-S proteins, the following recommendations can be made:

  • Buffer Composition:

    • Tris/PBS-based buffer at pH 8.0 has been successfully used for recombinant petC

    • Include 6% Trehalose as a stabilizing agent

    • Consider adding reducing agents such as DTT or β-mercaptoethanol at low concentrations to prevent oxidation of the Fe-S cluster

    • Maintain physiological ionic strength (approximately 150 mM NaCl)

    • Avoid transition metal contaminants that could promote oxidative damage

  • Storage Conditions:

    • Store at -20°C or -80°C for long-term storage

    • Add 5-50% glycerol as a cryoprotectant (50% is recommended in search result )

    • Aliquot the protein to avoid repeated freeze-thaw cycles

    • For working stocks, store at 4°C for up to one week

  • Reconstitution Protocol:

    • Briefly centrifuge vials before opening to bring contents to the bottom

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Allow complete dissolution before use

    • Consider adding glycerol to reconstituted protein for improved stability

  • Handling Precautions:

    • Minimize exposure to air/oxygen, particularly for concentrated stocks

    • Work quickly and keep samples on ice when outside of freezer storage

    • Consider handling under anaerobic conditions for sensitive applications

    • Monitor protein integrity after storage using spectroscopic methods

Storage PurposeTemperatureAdditivesMaximum Duration
Long-term storage-80°C50% glycerol, 6% trehaloseMonths to years
Medium-term storage-20°C50% glycerol, 6% trehaloseSeveral months
Working stock4°CBuffer onlyUp to one week
Experimental useOn iceBuffer onlyHours

These recommendations should be validated for each specific recombinant petC preparation, as minor differences in protein production can affect stability profiles.

How can isotope-labeled recombinant petC be efficiently produced for structural studies?

Producing isotope-labeled recombinant petC for structural studies, particularly NMR spectroscopy, requires specific methodological considerations to ensure both adequate labeling and maintenance of protein function:

  • Expression System Selection:

    • E. coli remains the preferred system for isotope labeling due to cost-effectiveness and high efficiency

    • Based on search result , E. coli has been successfully used for petC expression and could be adapted for isotope labeling

    • Consider specialized strains optimized for expression of complex proteins with cofactors

  • Minimal Media Formulation:

    • Use M9 minimal media or similar formulations that allow precise control of nitrogen and carbon sources

    • For 15N labeling, use 15NH4Cl as the sole nitrogen source

    • For 13C labeling, use 13C-glucose as the sole carbon source

    • For deuteration, prepare media in D2O and use deuterated carbon sources

    • Supplement with trace elements to support Fe-S cluster formation

  • Optimized Protocol for Labeled petC:

    • Pre-culture cells in rich media to generate biomass

    • Wash cells and transfer to minimal media containing isotope label(s)

    • Allow adaptation period before induction

    • Consider lower temperatures (18-25°C) and longer induction times to maximize yield in minimal media

    • Harvest when expression reaches optimal levels (determined by pilot experiments)

  • Purification Considerations:

    • Follow similar purification strategies as for unlabeled protein

    • Monitor isotope incorporation by mass spectrometry

    • Be aware that yields are typically lower in minimal media (expect 30-50% of rich media yields)

  • Specific Yield Enhancement Strategies:

    • Use high-density cell culture techniques

    • Consider ISOGRO™ or similar commercially available labeled media supplements

    • Optimize inducer concentration specifically for minimal media conditions

    • Add iron supplements to support Fe-S cluster formation

From search result , we know that about 63.0 mg/L of 15N-labeled recombinant protein (in that case another pea protein) was achieved using optimized expression with buffered basal salt media. This suggests that similar yields might be possible for petC with appropriate optimization.

Labeling TypeApplicationExpected Yield ReductionSpecial Considerations
15N onlyStandard NMR studies, backbone assignment~30-40%Relatively straightforward adaptation of protocols
13C, 15NComplete NMR assignments, detailed structure~40-50%More expensive; optimize carbon source concentration
2H, 13C, 15NStudies of larger proteins~60-70%Requires adaptation to deuterated media; slower growth
Selective labelingSpecific structural questionsVariesRequires auxotrophic strains or specific supplementation

What analytical techniques are most informative for characterizing recombinant petC?

A comprehensive characterization of recombinant petC requires multiple analytical techniques addressing different aspects of the protein's properties:

For most applications, a combination of SDS-PAGE, Western blotting, UV-visible spectroscopy, and at least one functional assay would provide a solid characterization foundation, with additional techniques selected based on specific research questions.

How can researchers integrate petC functional data with broader photosynthetic pathway analyses?

Integrating petC functional data with broader photosynthetic pathway analyses requires approaches that connect molecular-level information about this specific protein with system-level understanding of photosynthesis:

From search result , we know that reduced petC expression in a Lemna perpusilla mutant affected the stability of other cytochrome b6f complex components. This exemplifies how molecular data about petC can be connected to broader protein complex stability and function.

What statistical approaches are most appropriate for analyzing petC expression data across different experimental conditions?

When analyzing petC expression data across different experimental conditions, researchers should consider the following statistical approaches:

  • Normalization Methods:

    • For qPCR data: Use multiple reference genes for normalization, particularly those stable under the experimental conditions

    • For protein quantification: Normalize to total protein, housekeeping proteins, or use absolute quantification standards

    • Compare results using different normalization methods to ensure robustness

  • Statistical Tests for Comparing Expression Levels:

    • For normally distributed data: t-tests (two conditions) or ANOVA (multiple conditions) with appropriate post-hoc tests

    • For non-normally distributed data: Non-parametric alternatives such as Mann-Whitney U or Kruskal-Wallis tests

    • Include corrections for multiple testing (e.g., Bonferroni, Benjamini-Hochberg) when comparing across multiple conditions

  • Correlation Analyses:

    • Pearson correlation for linear relationships between petC expression and physiological parameters

    • Spearman correlation for non-linear or rank-based relationships

    • Multiple regression models to understand how different factors collectively influence petC expression

  • Multifactorial Approaches:

    • Two-way or multi-way ANOVA to understand interactions between different experimental factors

    • Mixed models when including random effects or repeated measures

    • Multivariate methods (PCA, PLS-DA) to understand patterns across multiple genes or proteins

From the pea cultivation studies in search result , we know that environmental factors can significantly affect plant physiology. For petC expression studies, it would be important to consider how factors like temperature, photoperiod, and light intensity might interact, suggesting that multifactorial approaches would be particularly valuable.

A typical analysis workflow might include:

  • Data quality assessment and outlier detection

  • Normalization using multiple reference genes

  • Exploratory data analysis with visualization of means, distributions, and correlations

  • Formal statistical testing using appropriate models for the experimental design

  • Post-hoc comparisons and correction for multiple testing

  • Integration with other data types (e.g., photosynthetic parameters, growth measurements)

  • Validation of key findings using independent methods

How can researchers use recombinant petC to study adaptation of photosynthesis to extreme environments?

The use of recombinant petC provides valuable opportunities to investigate photosynthetic adaptation to extreme environments, particularly when combined with insights from plants adapted to challenging conditions:

  • Comparative Analysis of petC Variants:

    • Express recombinant petC from plants adapted to different environments (e.g., Arctic peas described in search result )

    • Compare biochemical properties, especially redox characteristics and stability

    • Perform site-directed mutagenesis to identify key amino acid residues responsible for adaptive properties

  • In Vitro Stress Tolerance Studies:

    • Expose recombinant petC to conditions mimicking environmental stresses (temperature extremes, salinity, etc.)

    • Measure effects on protein stability, Fe-S cluster integrity, and electron transfer capability

    • Compare stress responses of petC variants from different ecotypes or species

  • Recombinant Protein Complementation:

    • Introduce recombinant petC variants into mutant plants lacking functional petC

    • Assess restoration of photosynthetic function under various environmental conditions

    • Quantify differences in complementation efficiency across stress treatments

  • Structure-Function Relationship Studies:

    • Use recombinant proteins to determine structural features associated with environmental adaptation

    • Correlate structural differences with functional parameters under stress conditions

    • Employ techniques like hydrogen-deuterium exchange mass spectrometry to identify regions with altered conformational dynamics

  • Evolutionary Analysis Applications:

    • Express ancestral or synthetic petC variants reconstructed through evolutionary analysis

    • Test hypotheses about the adaptive trajectory of petC across environmental gradients

    • Identify convergent evolutionary solutions to similar environmental challenges

From search result , we know that peas show specific adaptations to Arctic conditions, including responses to extreme day length and temperature regimes. The study of petC variants from these adapted plants could provide insights into how the photosynthetic electron transport chain adapts to such conditions, potentially informing strategies for crop improvement in the face of climate change.

What are the future research directions for recombinant petC in photosynthesis research?

Based on the available search results and current understanding of petC, several promising future research directions emerge:

  • Structure-Function Relationships:

    • High-resolution structural studies of recombinant petC using advanced techniques like cryo-EM

    • Mutagenesis studies targeting specific residues involved in Fe-S cluster binding or electron transfer

    • Investigation of how petC interacts with other components of the cytochrome b6f complex

  • Environmental Adaptation Studies:

    • Investigation of how petC variants from plants adapted to different environments (like the Arctic-adapted peas in ) perform functionally

    • Analysis of how petC contributes to photosynthetic efficiency under changing climate conditions

    • Exploration of petC roles in stress responses, particularly oxidative stress

  • Synthetic Biology Applications:

    • Engineering petC variants with altered redox properties to modify electron flow in photosynthesis

    • Creation of chimeric proteins combining domains from different species to understand evolutionary adaptations

    • Development of biosensors based on the electron transfer properties of petC

  • Systems Biology Integration:

    • Comprehensive mapping of petC interactions within the photosynthetic apparatus

    • Integration of petC functional data with whole-plant physiological responses

    • Development of predictive models for photosynthetic performance based on petC properties

  • Translational Research:

    • Utilization of insights from recombinant petC studies to identify targets for crop improvement

    • Development of screening methods for identifying superior petC variants in germplasm collections

    • Creation of diagnostic tools for assessing photosynthetic efficiency based on petC function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.