Recombinant Pisum sativum Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification is required for dry ice shipments, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Pisum sativum (Garden pea)
Target Names
petD
Target Protein Sequence
MGVTKKPDLTDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTVVALWLGIGATLPIEKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, this protein mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex and what role does petD play within it?

The Cytochrome b6-f complex is a crucial component of the photosynthetic electron transport chain in Pisum sativum (pea). PetD, also known as subunit 4, is one of the core subunits of this complex. Research has demonstrated that PetD forms a subcomplex with Cytochrome b6 that serves as a template for the assembly of other components including Cytochrome f and PetG .

In the fully assembled complex, PetD works alongside other proteins including PetC and PetL to form a functional dimer. Importantly, PetD becomes highly unstable in the absence of Cytochrome b6, indicating their interdependent relationship in complex formation . The synthesis of Cytochrome f is greatly reduced when either Cytochrome b6 or PetD is inactivated, demonstrating that both are prerequisites for Cytochrome f synthesis through a mechanism known as CES (controlled by epistasy of synthesis) .

How is the Cytochrome b6-f complex assembled in Pisum sativum?

The assembly of the Cytochrome b6-f complex follows a sequential process that has been well-characterized through research. The assembly pathway involves:

  • Formation of a mildly protease-resistant subcomplex between Cytochrome b6 and PetD

  • This subcomplex serving as a template for the assembly of Cytochrome f and PetG, producing a protease-resistant cytochrome moiety

  • Final participation of PetC and PetL proteins in the assembly of the functional dimer

This assembly process is regulated through the CES mechanism, where the synthesis rate of chloroplast-encoded subunits is regulated by the availability of their assembly partners. Specifically, the synthesis of Cytochrome f has been shown to be regulated by the assembly state of Cytochrome b6 or PetD . Unassembled Cytochrome f can inhibit its own translation through a negative feedback mechanism, which has been particularly well-studied in Chlamydomonas reinhardtii where proteins MCA1 and TCA1 are involved in this regulation .

What techniques are most effective for studying recombinant petD expression and function?

Several sophisticated techniques are commonly employed for studying recombinant petD expression and function:

  • Immunoblot Analysis: This technique uses anti-PetD antibodies to detect and quantify PetD protein levels in experimental samples. Researchers can resolve proteins using electrophoresis followed by immunoblotting to specifically identify PetD .

  • Pulse Labeling: This approach involves labeling newly synthesized proteins with radioactive amino acids for specific time periods (e.g., 10 minutes, 30 minutes) to track protein synthesis and degradation rates. Research has shown that in dac mutants, PetD levels were 30-40% of wild-type levels after 10 minutes of pulse labeling and more than 80% lower after 30 minutes .

  • Polysome Association Analysis: This technique examines whether transcripts like petD are actively being translated by analyzing their association with polysomes. Research has shown that petD transcript association with polysomes remains unperturbed in dac mutants, indicating that translation initiation is not affected .

  • Mutant Analysis: Studying mutants with defects in the accumulation of Cytochrome b6/f complex (such as dac mutants) provides valuable insights into the role of specific proteins in complex assembly and stability .

How does the DAC protein influence petD stability and Cytochrome b6-f complex assembly?

The DAC (Defective Accumulation of Cytochrome b6/f complex) protein plays a critical role in the accumulation and stability of the Cytochrome b6-f complex components. Research with dac mutants has revealed several important impacts:

  • In dac mutants, the levels of Cytochrome f and PetD are significantly reduced compared to wild-type plants (30-40% of wild-type levels after 10 minutes of pulse labeling and more than 80% lower after 30 minutes) .

  • A considerable portion of newly synthesized PetD, Cytochrome b6, and Cytochrome f is rapidly degraded in these mutants .

  • Despite high degradation rates, approximately 10-15% of Cytochrome b6/f proteins still accumulate in a stable manner in dac mutants .

Importantly, analysis of the association of petD transcripts with polysomes showed that translation initiation remains normal in dac mutants. This indicates that DAC's role is primarily post-translational, likely involved in the assembly of PetD into the Cytochrome b6/f complex rather than affecting protein synthesis . The reduced accumulation of Cytochrome b6/f components in dac mutants appears to result from rapid degradation of newly synthesized proteins that cannot be efficiently assembled into functional complexes .

What kinetic parameters govern petD assembly into the Cytochrome b6-f complex?

The assembly of petD into the Cytochrome b6-f complex involves several kinetic parameters that can be measured and analyzed:

ParameterWild-type Plantsdac MutantsSignificance
PetD Synthesis RateNormalNormalTranslation initiation unaffected in mutants
PetD Stability (10 min)Stable30-40% of wild-typeRapid initial degradation in mutants
PetD Stability (30 min)Stable<20% of wild-typeProgressive degradation over time
Complex AssemblyCompleteImpairedAssembly defect in mutants
Cytochrome f SynthesisNormalReducedSecondary effect through CES mechanism

This data indicates that in wild-type plants, newly synthesized PetD is efficiently incorporated into stable complexes, while in dac mutants, a significant portion is rapidly degraded . The kinetics suggest a two-phase process where newly synthesized PetD either gets incorporated into stable complexes or undergoes rapid degradation if assembly is impaired.

Experimental approaches to measure these parameters include pulse-chase experiments, which can determine the half-life of PetD under different conditions, and time-course assembly assays to track the sequential formation of subcomplexes and complete complexes .

What mechanisms coordinate nuclear-encoded and chloroplast-encoded subunits of the Cytochrome b6-f complex?

The coordinated expression of nuclear-encoded and chloroplast-encoded subunits of the Cytochrome b6-f complex involves several sophisticated regulatory mechanisms:

  • CES Mechanism: The Controlled by Epistasy of Synthesis (CES) mechanism regulates the synthesis rate of chloroplast-encoded subunits like Cytochrome f based on the availability of assembly partners. Research shows that unassembled Cytochrome f can inhibit its own translation through a negative feedback mechanism .

  • Assembly-Dependent Protein Stability: Proteins that fail to properly assemble are targeted for rapid degradation. In dac mutants, newly synthesized PetD, Cytochrome b6, and Cytochrome f showed increased degradation rates, demonstrating how assembly status affects protein stability .

  • Post-Transcriptional Regulation: Specific factors like MCA1 and TCA1 have been identified in Chlamydomonas reinhardtii as regulators of Cytochrome f synthesis, suggesting sophisticated mechanisms for coordinating complex component expression .

  • Polysome Association Control: The regulation of translation initiation through control of mRNA association with polysomes represents another layer of regulation, although research with dac mutants indicates this mechanism is not affected for petD in these particular mutants .

What protocols are most effective for isolating and purifying recombinant Pisum sativum petD?

Isolating and purifying recombinant Pisum sativum petD requires specialized approaches due to its nature as a membrane protein that functions as part of a multi-subunit complex:

  • Co-Expression Strategy: Since research has demonstrated that PetD becomes unstable in the absence of Cytochrome b6, a co-expression strategy is essential for producing stable recombinant protein. Expressing PetD together with at least Cytochrome b6, or ideally with all components required for the minimal functional unit, will enhance stability .

  • Membrane Protein Extraction:

    • Use mild detergents optimized for membrane protein extraction

    • Employ gentle solubilization conditions to maintain complex integrity

    • Consider the lipid environment necessary for protein stability

  • Verification Methods:

    • Use immunoblotting with anti-PetD antibodies to confirm the presence and integrity of purified protein

    • Assess complex formation through size exclusion chromatography

    • Verify functionality through electron transport activity assays

Research with dac mutants has shown that PetD rapidly degrades when not properly assembled, with only 10-15% of proteins accumulating in a stable manner . This highlights the importance of considering assembly partners when designing purification strategies.

How can researchers study the interaction between petD and other subunits of the Cytochrome b6-f complex?

Studying the interactions between petD and other subunits requires multiple complementary approaches:

  • Biochemical Approaches:

    • Co-immunoprecipitation using anti-PetD antibodies to pull down interacting partners

    • Cross-linking followed by mass spectrometry to identify interaction interfaces

    • Size exclusion chromatography to analyze complex formation

  • Genetic Approaches:

    • Analysis of mutants defective in complex assembly (such as dac mutants)

    • Creation of site-directed mutations in regions involved in subunit interactions

    • Complementation studies with modified versions of petD

  • Structural Approaches:

    • Cryo-electron microscopy for high-resolution structural analysis

    • Homology modeling based on related structures

    • Mapping of conserved regions likely involved in interactions

Research has established that Cytochrome b6 and PetD form a mildly protease-resistant subcomplex that serves as a template for the assembly of Cytochrome f and PetG . This subcomplex represents a key interaction that can be studied using the approaches outlined above.

How should researchers analyze petD degradation kinetics in wild-type and mutant plants?

Analyzing petD degradation kinetics requires sophisticated experimental design and data analysis:

  • Pulse-Chase Experimental Design:

    • Pulse-label proteins with radioactive amino acids

    • "Chase" with non-radioactive amino acids for various time periods

    • Immunoprecipitate PetD at each time point and quantify radioactivity

  • Kinetic Modeling:

    • First-order decay equations: P(t) = P₀e^(-kt)

    • Half-life calculation: t₁/₂ = ln(2)/k

    • Compare degradation rates between wild-type and mutant plants

  • Data Interpretation:

    • Research with dac mutants showed PetD levels at 30-40% of wild-type after 10 minutes and below 20% after 30 minutes

    • This indicates rapid degradation rather than reduced synthesis in these mutants

    • Normal polysome association of petD transcripts confirms that translation initiation is not affected

  • Comparative Analysis:

    • Analyze how different mutations affect degradation kinetics

    • Compare effects of various experimental conditions on protein stability

    • Correlate degradation rates with complex assembly efficiency

How can researchers interpret contradictory findings regarding petD function across different experimental systems?

When confronted with contradictory findings about petD function in different experimental systems, researchers should consider:

  • Experimental System Differences:

    • Compare model organisms used (Pisum sativum vs. Chlamydomonas reinhardtii)

    • Consider developmental stages and growth conditions

    • Evaluate the specific genetic backgrounds of mutants

  • Methodological Variations:

    • Examine differences in protein extraction and detection methods

    • Consider the sensitivity and specificity of techniques used

    • Evaluate the use of different antibodies or tags

  • Biological Complexity Recognition:

    • Consider that apparent contradictions may reflect biological complexity

    • Recognize that assembly pathways may have redundant mechanisms

    • Acknowledge that different organisms may have evolved different regulatory mechanisms

For example, while the CES mechanism has been characterized in detail in Chlamydomonas reinhardtii, its specific operation may differ in higher plants like Pisum sativum . Similarly, the role of proteins like DAC may be specific to certain species or may have functional homologs with slightly different mechanisms in other organisms.

What are the most promising approaches for studying the evolutionary conservation of petD function?

Future research on petD evolutionary conservation could benefit from:

  • Comparative Genomics:

    • Sequence analysis across diverse plant species, from algae to angiosperms

    • Identification of conserved domains and critical residues

    • Analysis of selection pressure on different regions of the protein

  • Functional Complementation Studies:

    • Express petD from diverse species in model organisms like Chlamydomonas

    • Determine which functions are conserved across evolutionary distances

    • Identify species-specific adaptations in complex assembly

  • Structural Biology Approaches:

    • Compare structures of the Cytochrome b6-f complex across species

    • Identify conserved interaction interfaces

    • Correlate structural conservation with functional conservation

Research has already established the fundamental importance of petD in Cytochrome b6-f complex assembly across photosynthetic organisms, but detailed comparative studies could reveal how different species have optimized this process through evolution .

How might advanced genetic engineering techniques enhance our understanding of petD function?

Advanced genetic engineering approaches offer new possibilities for petD research:

  • CRISPR-Cas9 Genome Editing:

    • Create precise mutations in conserved residues

    • Generate conditional knockouts for studying essential functions

    • Introduce tagged versions of petD for in vivo tracking

  • Optogenetic Control Systems:

    • Develop light-responsive regulators of petD expression

    • Create systems for temporal control of complex assembly

    • Study the dynamics of complex formation in real-time

  • Synthetic Biology Approaches:

    • Design minimal versions of petD to identify essential functional domains

    • Create hybrid proteins to probe domain functions

    • Develop reporter systems for monitoring assembly in vivo

These approaches could help resolve outstanding questions about the precise role of petD in complex assembly, the mechanisms underlying the CES process, and the factors determining protein stability in different genetic backgrounds .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.