Recombinant Pisum sativum Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COX2; COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Pisum sativum (Garden pea)
Target Names
COX2
Target Protein Sequence
MKLEWLFLTIAPCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVSRILVRAL WHFHYKKNPIPQRIVHGTTIEILRTIFPSIIPMFIAIPSFALLYSMDGVLVDPAMTIKAI GHQWYRTYEYSDYNSSDEQSLTFDSYTIPEDDLELGQSGLLEVDNRVVVPAKTHLRIIVT PADVPHSWAVPSLGVKCDAVPGRLNQISISVQREGVYYGQCSEICGTNHAFPIVVEAVPS KDYGSRVSNQLIPQTGEA
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation, a crucial process for ATP production. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes collaborate to transfer electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase activity. COX2 plays a vital role in the final step, catalyzing the reduction of oxygen to water within the enzyme's binuclear center (BNC), composed of heme a3 and copper B (CuB). Electrons from reduced cytochrome c in the intermembrane space are transferred via the copper A center (CuA) and heme a to the BNC, where oxygen reduction occurs using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.