Recombinant Pisum sativum Defender against cell death 1 (DAD1)

What is Pisum sativum DAD1 and what role does it play in plant cellular processes?

Pisum sativum Defender against Cell Death 1 (DAD1) is a highly conserved protein comprising 117 amino acids with the sequence "MAKTSSTTKDAQDLFHAIWSAYSATPTNLKIIDLYVVFAVFTALLQDVYMALVGPFPFNS FLSGVLSCVGTAVLAVCLRIQVNKENKEFKDLGPERAFADFVLCNLVLHLVIMNFLG" . The protein functions as an anti-apoptotic factor that inhibits programmed cell death (PCD) in plants. DAD1 is an integral membrane protein localized primarily in the endoplasmic reticulum, where it participates in N-linked glycosylation as part of the oligosaccharyltransferase complex.

In pea plants, DAD1 is crucial for normal plant development and stress responses, including drought tolerance, pathogen defense, and senescence regulation. Research indicates that DAD1 expression patterns vary significantly across different tissues and developmental stages, with particularly high expression in actively growing tissues and during specific stress responses.

What expression systems are most effective for producing recombinant Pisum sativum DAD1?

The most common and effective expression system for recombinant Pisum sativum DAD1 is E. coli . The bacterial expression system offers several advantages for DAD1 production:

When expressing DAD1 in E. coli, optimal results are achieved using BL21(DE3) strain with expression induced by 0.5-1.0 mM IPTG at 18-20°C overnight. This lower temperature reduces inclusion body formation and improves the yield of soluble protein.

What is the recommended reconstitution protocol for lyophilized recombinant DAD1?

For optimal reconstitution of lyophilized recombinant Pisum sativum DAD1:

• Centrifuge the vial briefly (30 seconds at 10,000 × g) to collect the powder at the bottom before opening .

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

• For long-term storage, add glycerol to a final concentration of 5-50% (typically 50% is recommended) .

• Aliquot the reconstituted protein to minimize freeze-thaw cycles.

• Store aliquots at -20°C/-80°C for long-term storage or at 4°C for up to one week for working solutions .

The reconstituted protein should maintain >90% activity when properly stored. Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity.

What purification methods yield the highest purity for recombinant DAD1?

For His-tagged recombinant Pisum sativum DAD1, the following purification workflow achieves >90% purity :

• Cell Lysis: Sonication or pressure homogenization in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, and protease inhibitors.

• Primary Purification: Ni-NTA affinity chromatography

  • Binding: Load clarified lysate onto Ni-NTA column equilibrated with lysis buffer

  • Washing: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20 mM imidazole

  • Elution: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 250 mM imidazole

• Secondary Purification: Size exclusion chromatography (Superdex 75)

  • Buffer: PBS or 20 mM Tris-HCl pH 7.5, 150 mM NaCl

• Quality Control: SDS-PAGE and Western blot analysis to confirm >90% purity

For detergent-solubilized membrane proteins like DAD1, including 0.1% DDM (n-Dodecyl β-D-maltoside) or 0.5% CHAPS in all buffers improves protein stability and prevents aggregation during purification.

How can researchers design experiments to study DAD1's role in plant programmed cell death pathways?

Investigating DAD1's role in programmed cell death (PCD) requires a multi-faceted experimental approach:

• Gene Silencing Experiments:

  • RNAi or CRISPR-Cas9 to create DAD1-knockout or knockdown lines

  • Monitor cellular phenotypes using TUNEL assay, Annexin V staining, and caspase-like activity measurements

  • Compare PCD markers in wild-type versus DAD1-deficient plants under normal and stress conditions

• Protein-Protein Interaction Analysis:

  • Yeast two-hybrid screening to identify DAD1 interactors

  • Co-immunoprecipitation (Co-IP) using anti-His antibodies for recombinant His-tagged DAD1

  • Bimolecular fluorescence complementation (BiFC) to visualize interactions in planta

• Subcellular Localization Studies:

  • Fusion of DAD1 with fluorescent proteins (e.g., GFP, mCherry)

  • Co-localization with ER markers (e.g., calnexin, BiP)

  • Immunogold electron microscopy for high-resolution localization

• Stress Response Assays:

  • Apply abiotic stressors (drought, salt, heat) and measure DAD1 expression levels

  • Challenge with pathogen elicitors and monitor DAD1 regulation

  • Compare wild-type and DAD1-modified plants for stress tolerance phenotypes

• Transgenic Complementation:

  • Reintroduce wild-type or mutant DAD1 into knockout lines

  • Assess restoration of normal phenotype and PCD regulation

For quantitative analysis, researchers should employ qRT-PCR, Western blotting, and proteomics approaches to measure changes in DAD1 expression levels and the broader impact on the cellular proteome.

What functional assays best determine the biological activity of recombinant DAD1?

Several complementary assays can be employed to validate the biological activity of recombinant Pisum sativum DAD1:

• Cell Death Suppression Assay:

  • Transform DAD1-deficient plant cells with recombinant DAD1

  • Induce PCD using elicitors (e.g., H₂O₂, heat shock)

  • Measure cell viability using MTT/XTT assays or Evans blue staining

  • Active DAD1 will reduce PCD rates compared to controls

• Oligosaccharyltransferase (OST) Complex Activity Assay:

  • Reconstitute OST complex in vitro with purified components including recombinant DAD1

  • Measure N-glycosylation activity using fluorescent substrates

  • Quantify glycosylation efficiency by HPLC or mass spectrometry

• Thermal Shift Assay (TSA):

  • Assess protein stability and folding by monitoring temperature-dependent denaturation

  • Active, properly folded DAD1 will show a characteristic melting curve

  • Compare with known standards or previous batches

• Circular Dichroism (CD) Spectroscopy:

  • Analyze secondary structure of recombinant DAD1

  • Confirm proper folding compared to native protein

  • Detect structural changes in response to different buffer conditions

• Binding Partner Interaction Assays:

  • Surface Plasmon Resonance (SPR) to measure binding kinetics with known partners

  • Microscale Thermophoresis (MST) to detect interactions in solution

  • AlphaScreen or ELISA-based methods for high-throughput interaction screening

The combination of these assays provides comprehensive validation of recombinant DAD1 functionality across multiple parameters.

How can researchers analyze contradictory data in DAD1 expression studies across different plant tissues?

When faced with contradictory data in DAD1 expression studies, researchers should implement a systematic approach:

• Standardize Methodology:

  • Use identical sampling procedures across tissues

  • Normalize gene expression to multiple, validated reference genes

  • Apply consistent extraction protocols optimized for membrane proteins

• Technical Validation:

  • Employ multiple detection methods (qRT-PCR, Western blot, immunohistochemistry)

  • Use different primer sets or antibodies to verify results

  • Include appropriate positive and negative controls in all experiments

• Developmental Stage Analysis:

  • Create a temporal expression map across plant development

  • Sample tissues at precise developmental stages rather than arbitrary time points

  • Consider circadian regulation of expression

• Environmental Variable Control:

  • Document and standardize all growth conditions (light, temperature, humidity)

  • Account for stress exposure history of plant material

  • Design factorial experiments to identify interaction effects

• Statistical Analysis Framework:

  • Apply appropriate statistical tests for expression data (often non-parametric)

  • Use multiple comparison corrections for large-scale analyses

  • Consider Bayesian approaches for integrating diverse datasets

By implementing these approaches, researchers can reconcile seemingly contradictory results and develop a more nuanced understanding of tissue-specific DAD1 expression patterns.

What are the most effective protocols for studying DAD1 protein interactions with other components of the N-glycosylation machinery?

Studying DAD1's interactions with other components of the N-glycosylation machinery requires specialized approaches for membrane protein complexes:

• Membrane-Based Yeast Two-Hybrid (MYTH):

  • Split-ubiquitin system specifically designed for membrane proteins

  • Allows detection of interactions in a near-native membrane environment

  • Screen DAD1 against cDNA libraries to identify novel interactors

• Tandem Affinity Purification (TAP):

  • Express His-tagged DAD1 with a secondary affinity tag (e.g., FLAG)

  • Perform sequential purification to isolate intact complexes

  • Identify components by mass spectrometry

  • Protocol modification: include mild detergents (0.1% DDM or 0.5% digitonin) throughout purification

• Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Map interaction interfaces between DAD1 and binding partners

  • Identify conformational changes upon complex formation

  • Provides structural insights without need for crystallization

• Proximity Labeling:

  • Fuse DAD1 to BioID or APEX2 enzymes

  • Proximity-dependent biotinylation of neighboring proteins

  • Identify labeled proteins by streptavidin pulldown and mass spectrometry

  • Especially valuable for transient interactions in the ER membrane

• Cryo-Electron Microscopy:

  • Visualize the structure of DAD1 within the OST complex

  • Prepare samples in detergent micelles or nanodiscs

  • Determine binding interfaces at near-atomic resolution

Recommended detergent screening for DAD1 complex isolation:

For functional validation of identified interactions, researchers should employ in vitro reconstitution of minimal complexes using purified components, followed by activity assays measuring N-glycosylation efficiency.

How does DAD1 expression respond to various abiotic and biotic stress conditions in Pisum sativum?

DAD1 expression in Pisum sativum exhibits dynamic responses to various environmental stressors, reflecting its role in stress adaptation and PCD regulation:

• Drought Stress Response:

  • Progressive upregulation of DAD1 during initial drought stages (1.5-2.5-fold increase after 3-5 days)

  • Expression peaks at moderate drought stress

  • Decline in expression under severe, prolonged drought conditions

  • Correlation with proline accumulation and antioxidant enzyme activities

• Temperature Stress Dynamics:

  • Cold stress (4°C): Rapid induction within 6-12 hours, sustained elevation for 24-48 hours

  • Heat stress (38°C): Biphasic response with initial decrease followed by significant upregulation after 24 hours

  • Expression patterns vary by tissue, with greater upregulation in young leaves compared to mature tissues

• Pathogen Challenge Responses:

  • Bacterial pathogens: Rapid upregulation (3-4 fold) within 6-12 hours post-infection

  • Fungal pathogens: More gradual induction, peaking at 24-48 hours

  • Specific elicitors (flg22, chitin): Transient expression spike (2-3 fold) within 1-3 hours

• Salt Stress Effects:

  • Moderate NaCl (100 mM): Gradual upregulation over 24-48 hours

  • High NaCl (200+ mM): Initial upregulation followed by decline as cellular damage progresses

  • Tissue-specific responses with stronger induction in roots compared to shoots

• Heavy Metal Exposure:

  • Cadmium and lead induce significant DAD1 upregulation (2-3 fold)

  • Copper shows minimal effect on expression

  • Correlation between DAD1 levels and cell survival under metal toxicity

Recommended experimental design for stress response studies:

For comprehensive analysis, combine transcriptomic (qRT-PCR), proteomic (Western blot), and physiological measurements (membrane integrity, ROS levels, photosynthetic efficiency) to correlate DAD1 expression with stress response phenotypes.

What are the critical factors affecting the stability and solubility of recombinant DAD1 during purification?

As a membrane protein, recombinant Pisum sativum DAD1 presents specific challenges during purification that require careful optimization:

• Detergent Selection and Concentration:

  • Critical micelle concentration (CMC) must be maintained throughout purification

  • Recommended detergents: DDM (0.05-0.1%), LMNG (0.01%), or CHAPS (0.5%)

  • Detergent screening should precede large-scale purification

• Buffer Composition Factors:

  • pH stability range: 7.0-8.5 (optimal: pH 7.5)

  • Salt concentration: 150-300 mM NaCl provides optimal stability

  • Glycerol (10-15%) significantly improves stability

  • Reducing agents (1-5 mM DTT or 1-2 mM β-mercaptoethanol) prevent oxidation

• Temperature Considerations:

  • All purification steps should be conducted at 4°C

  • Avoid freeze-thaw cycles during purification

  • For long-term storage, flash-freeze in liquid nitrogen and store at -80°C

• Protein Concentration Effects:

  • Concentration above 1 mg/mL increases aggregation risk

  • Add stabilizers (10% glycerol, 0.1% CHAPS) when concentrating

  • Use spin concentrators with 10 kDa MWCO cutoff

• Co-factors and Additives:

  • Divalent cations (1-2 mM Mg²⁺) improve stability

  • Lipid supplementation (0.01-0.05 mg/mL) enhances native conformation

  • Arginine (50-100 mM) reduces aggregation during concentration

Troubleshooting guide for common stability issues:

Implementation of these strategies can significantly improve the yield and quality of purified recombinant DAD1 protein.

How can researchers effectively design studies to examine DAD1's specific role in Pisum sativum stress responses?

Designing rigorous experiments to elucidate DAD1's specific role in pea stress responses requires careful control of variables and appropriate experimental systems:

• Genetic Manipulation Approaches:

  • CRISPR-Cas9 or VIGS (Virus-Induced Gene Silencing) for DAD1 knockdown/knockout

  • Complementation with wild-type and mutant versions (e.g., glycosylation site mutants)

  • Inducible expression systems to control timing of DAD1 perturbation

  • Generation of tissue-specific promoter-driven expression

• Physiological Stress Application Parameters:

  • Standardize stress intensity and duration across experiments

  • Apply multiple stress types individually and in combination

  • Include recovery phases to assess reversibility of responses

  • Monitor whole-plant and cellular responses simultaneously

• Experimental Controls and Comparisons:

  • Include wild-type plants grown under identical conditions

  • Manipulate related but distinct genes (e.g., other OST complex members)

  • Use positive controls with known stress response phenotypes

  • Include reference cultivars with differing stress tolerance

• Multi-Omics Integration Strategy:

  • Transcriptomics: RNA-Seq or microarray analysis of stress-responsive genes

  • Proteomics: Quantitative analysis of glycoprotein abundance and modification

  • Metabolomics: Profiling of stress-related metabolites

  • Phenomics: High-throughput phenotyping of morphological and physiological parameters

• Temporal Resolution Considerations:

  • Short-term responses (minutes to hours): Signaling events, immediate gene expression

  • Medium-term responses (hours to days): Protein level changes, metabolic adjustments

  • Long-term responses (days to weeks): Developmental adaptations, growth effects

Recommended experimental workflow:

This comprehensive approach allows for definitive characterization of DAD1's role in stress responses while controlling for confounding variables and providing multiple lines of evidence.

What approaches can resolve contradictory findings in studies of DAD1's interaction with the PCD machinery in plants?

Resolving contradictory findings regarding DAD1's interactions with programmed cell death machinery requires systematic analysis and methodological refinement:

• Critical Assessment of Experimental Systems:

  • Cell-free vs. cellular systems: Different environments may yield different results

  • Heterologous vs. homologous expression: Protein behavior may vary by expression context

  • Stress intensity: Varying stress levels may trigger different DAD1 interaction profiles

  • Developmental stage: DAD1 interactions may be stage-specific

• Protein Complex Isolation Optimization:

  • Membrane solubilization conditions: Test multiple detergents and concentrations

  • Crosslinking approaches: Use chemical crosslinkers with different spacer lengths

  • Native vs. denaturing conditions: Compare interaction profiles under different conditions

  • Temporal sampling: Capture dynamic interaction changes during stress response

• Multi-Method Validation Framework:

  • Orthogonal techniques: Combine Co-IP, BiFC, FRET, and proximity labeling

  • Functional assays: Validate interactions through activity measurements

  • In vitro reconstitution: Test direct interactions with purified components

  • Structural biology: Determine interaction interfaces through HDX-MS or Cryo-EM

• Bioinformatic Integration Strategy:

  • Comparative analysis: Assess conservation of interactions across species

  • Network modeling: Place contradictory findings in broader pathway context

  • Machine learning: Identify patterns in contradictory datasets to generate hypotheses

  • Molecular dynamics: Simulate DAD1 interactions under different conditions

• Biological Context Considerations:

  • Tissue-specific factors: Identify tissue-specific interaction partners or modifiers

  • Stress-specific regulation: Map interaction differences across stress types

  • Post-translational modifications: Assess impact of PTMs on interaction profiles

  • Spatiotemporal organization: Consider subcellular localization and timing

Decision matrix for resolving contradictory findings:

By systematically applying these approaches, researchers can transform seemingly contradictory results into a more nuanced understanding of DAD1's context-specific interactions and functions in the plant PCD machinery.

What emerging technologies offer new insights into DAD1 function and regulation in Pisum sativum?

Several cutting-edge technologies are poised to revolutionize our understanding of DAD1 function and regulation:

• Single-Cell Transcriptomics and Proteomics:

  • Reveals cell-type specific DAD1 expression patterns

  • Identifies heterogeneous responses within tissues

  • Enables construction of cell-state trajectories during stress responses

  • Allows correlation of DAD1 expression with cellular differentiation states

• Cryo-Electron Tomography:

  • Visualizes DAD1 in its native membrane environment

  • Resolves structural organization within the OST complex

  • Captures conformational changes during glycosylation

  • Provides insights into membrane topology and protein interactions

• AlphaFold2 and Molecular Dynamics Simulations:

  • Predicts DAD1 structure with high accuracy

  • Models protein-protein and protein-lipid interactions

  • Simulates conformational changes under different conditions

  • Identifies potential binding sites for regulatory molecules

• Genome Editing with Prime Editing Technology:

  • Enables precise modification of DAD1 residues without double-strand breaks

  • Creates tailored mutations to test specific hypotheses

  • Generates allelic series to map structure-function relationships

  • Introduces tagged versions at endogenous loci

• Spatially Resolved Transcriptomics:

  • Maps DAD1 expression in intact tissues with subcellular resolution

  • Correlates expression with physiological and developmental gradients

  • Identifies spatial regulation during stress responses

  • Reveals coordination with other stress response factors

Potential applications and expected outcomes:

These emerging technologies will provide unprecedented insights into DAD1's molecular mechanisms and physiological roles in Pisum sativum stress responses and development.

How can comparative studies across species enhance our understanding of DAD1 function in Pisum sativum?

Comparative analysis across species offers powerful approaches to elucidate DAD1 function in Pisum sativum:

• Evolutionary Conservation Analysis:

  • Compare DAD1 sequences across plant kingdom to identify conserved domains

  • Map conservation onto structural models to predict functional regions

  • Identify species-specific variations that correlate with ecological adaptations

  • Construct phylogenetic frameworks to trace functional divergence

• Cross-Species Functional Complementation:

  • Express Pisum sativum DAD1 in model systems (Arabidopsis, tobacco, yeast)

  • Test rescue of dad1 mutant phenotypes across species

  • Identify species-specific cofactors through complementation efficiency

  • Create chimeric proteins to map functional domains

• Comparative Stress Response Profiling:

  • Compare DAD1 expression patterns under identical stressors across species

  • Identify conserved and divergent regulatory elements

  • Correlate DAD1 regulation with species-specific stress tolerance

  • Develop predictive models for stress response strategies

• Multi-Species Interactome Mapping:

  • Compare DAD1 protein interaction networks across plant species

  • Identify core conserved interactions vs. species-specific ones

  • Map interaction conservation to functional significance

  • Predict novel interactions based on conservation patterns

• Comparative Glycoproteomics:

  • Profile N-glycosylated proteins across species with varied DAD1 activity

  • Identify conserved glycosylation targets vs. species-specific ones

  • Correlate glycoproteome with stress response phenotypes

  • Map evolutionary divergence of N-glycosylation machinery

Implementation strategy and expected outcomes:

By integrating these comparative approaches, researchers can distinguish between conserved core functions and species-specific adaptations of DAD1 in Pisum sativum, providing insights into both fundamental mechanisms and potential applications in crop improvement.