Full Name Recombinant Full Length Pisum Sativum Early Light-Induced Protein, Chloroplastic Protein, His-Tagged
Purity Greater or equal to 85% purity as determined by SDS-PAGE
Subcellular location Plastid, chloroplast membrane; Multi-pass membrane protein
ELIPs likely participate in integrating pigments into mature pigment-protein complexes .
ELIP gene expression is induced by light, specifically blue and red light, and other environmental stresses such as UV-B radiation, salt, and wounding . The steady-state level of ELIP transcripts depends on the age of the seedlings and is controlled by the combined action of phytochrome and blue light receptor systems . Blue light regulates the stability of ELIP transcripts and acts at the level of transcription in a light intensity-dependent manner . Accumulation of ELIP transcripts requires "plastid factors" in both blue and red light qualities .
ELIP is found in both grana and stroma thylakoids, but it is not uniformly distributed. Approximately 60-70% of ELIP is located in the stroma thylakoids, while 30-40% is found in the grana thylakoids . This distribution aligns with photosystem I, and after solubilization with Triton-X-100, almost all ELIP is found in the photosystem-I-containing fraction, suggesting an association with photosystem I .
Light-dependent chloroplast movements are induced by blue light . Under low light, chloroplasts accumulate in periclinal layers to optimize light absorption, while under high light, they become positioned parallel to the incoming light to reduce exposure to damaging light intensities . Mutants with altered chloroplast movements have been identified, including plastid movement impaired1 (pmi1), which shows severely attenuated chloroplast movements . The pmi1 phenotype is caused by a mutation in the gene At1g42550, encoding a plant-specific protein that may be involved in phototropin signal transduction to the actin cytoskeleton .
Early Light-Induced Proteins (ELIPs) in Pisum sativum are chloroplast proteins that are expressed before other chloroplast proteins in the presence of light. The mature protein spans amino acids 49-196 and contains chlorophyll-binding motifs similar to those found in the light-harvesting complex (LHC) proteins . The full amino acid sequence of the mature protein is: AEGEPKEQSKVAVDPTTPTASTPTPQPAYTRPPKMSTKFSDLMAFSGPAPERINGRLAMI GFVAAMGVEIAKGQGLSEQLSGGGVAWFLGTSVLLSLASLIPFFQGVSVESKSKSIMSSD AEFWNGRIAMLGLVALAFTEFVKGTSLV . This sequence reveals hydrophobic regions that facilitate membrane integration in the thylakoid membrane. The protein belongs to the LHC-like protein family, which has been well-characterized in numerous plant species, with significant structural conservation across various species suggesting important functional roles in photosynthetic organisms.
ELIP is primarily localized in the thylakoid membranes of chloroplasts in pea cells, with a non-uniform distribution between grana and stroma thylakoids. Studies using antibodies against bacterial-expressed fusion proteins containing ELIP sequences have demonstrated that approximately 60-70% of ELIP is found in stroma thylakoids, while only 30-40% is present in grana thylakoids . This distribution pattern closely resembles that of photosystem I rather than photosystem II, suggesting a potential functional association with PSI. After Triton-X-100 solubilization of thylakoid membranes, almost all ELIP is recovered in the photosystem-I-containing fraction, further supporting this association . The predominant localization in stroma thylakoids suggests that ELIP may play specialized roles in these regions, potentially related to photoprotection or other stress responses that primarily involve PSI rather than PSII.
The expression of ELIP in pea seedlings follows a dynamic temporal pattern in response to light exposure. When dark-grown pea seedlings are illuminated, ELIP accumulation in thylakoid membranes increases progressively, reaching maximum levels at approximately 16 hours of continuous illumination . Following this peak, ELIP levels begin to decrease if illumination continues beyond 16 hours, indicating a transient expression pattern rather than sustained accumulation . This temporal profile suggests that ELIP serves as an acclimation protein during the initial exposure to light, potentially protecting the developing photosynthetic apparatus from light stress while it matures. The decline in ELIP levels after prolonged illumination likely indicates that once full photosynthetic capacity is established, other photoprotective mechanisms take over, reducing the need for ELIP-mediated protection. This expression pattern supports the hypothesis that ELIP functions as a transient pigment-binding protein that protects chloroplasts from photodamage during periods of adjustment to changing light conditions .
ELIP expression in Pisum sativum is induced by multiple environmental stressors, with varying levels of response depending on the specific stress. UV-B radiation is a particularly strong inducer, with research showing that even low levels of UV-B cause rapid and strong induction of ELIP mRNA . This is especially notable because ELIP is one of the few photosynthetic genes that is up-regulated following exposure to UV-B, contrasting with most plastid-localized proteins whose genes are typically down-regulated by UV-B . Additionally, salt stress and wounding treatments have been shown to induce increased transcript levels of ELIP in pea plants, demonstrating the protein's broader role in various stress responses . Interestingly, ozone fumigation does not appear to trigger ELIP expression, suggesting specificity in the stress-response pathways that regulate this gene . The diverse array of stresses that induce ELIP expression indicates its importance as a component of the plant's integrated stress response system, particularly in protecting photosynthetic machinery under adverse conditions.
Temperature and light intensity interact to regulate ELIP expression in pea plants in a complex manner. Research comparing pea with grapevine has shown that maximum ELIP expression occurs at temperatures from 25°C and light intensity of 1000 μmol PAR m-2 s-1 . Above these threshold values, expression remains relatively constant rather than increasing further, suggesting a saturation point in the response. Regarding photoinhibition, temperature appears to have an inverse relationship with ELIP expression in grapevine but shows no clear correlation in pea, highlighting species-specific differences in response mechanisms . In contrast, increasing light intensity shows a direct relationship with both ELIP expression and photoinhibition in both species. These findings suggest that while light intensity consistently drives ELIP expression across species, temperature effects may be more species-dependent and related to the plants' natural habitat and adaptation strategies. This temperature-light interaction indicates that ELIP may serve different photoprotective functions depending on the specific combination of environmental conditions.
The molecular regulation of ELIP expression involves sophisticated responses to different light qualities. Studies in related species have shown that both red and blue light can trigger ELIP expression, but their effects are not simply additive and instead exhibit complex interactions . When plants are exposed to red light for 2 hours followed by blue light for 2 hours, ELIP1 transcript abundance increases approximately 5-fold compared to control levels, indicating that blue light somewhat dampens the response to red light . Interestingly, when the treatment order is reversed (blue light followed by red light), ELIP1 transcript abundance remains at control levels, suggesting that red light can completely inhibit the blue light response . For ELIP2, a related gene, a 2-hour exposure to red light followed by 2 hours of blue light elevates transcript abundance 15-fold, while the reverse treatment order produces no response . These findings indicate that red and blue light signaling pathways interact in regulating ELIP expression, with red light having a dominant effect that can override blue light signals. This complex regulation likely involves multiple photoreceptors, including phytochromes (red light) and cryptochromes (blue light), functioning in a hierarchical manner to fine-tune ELIP expression in response to changing light environments.
The optimal production of recombinant pea ELIP protein involves expression in E. coli with an N-terminal His-tag fusion using the mature protein sequence (amino acids 49-196) . For efficient expression, the protein-coding region should be codon-optimized for E. coli and cloned into an appropriate expression vector with an inducible promoter system, such as T7 or pET. The expression is typically induced when bacterial cultures reach mid-log phase (OD600 of 0.6-0.8) using IPTG at concentrations between 0.5-1 mM. Since ELIP is a membrane protein, expression conditions should be optimized to prevent the formation of inclusion bodies, which may include lowering the induction temperature to 16-20°C and extending expression time to 16-20 hours. For purification, the recombinant protein should be extracted using specialized buffers containing mild detergents like Triton X-100 to solubilize the membrane-associated protein, followed by immobilized metal affinity chromatography (IMAC) using Ni-NTA resins to capture the His-tagged protein. Final purification steps often include size-exclusion chromatography to achieve greater than 90% purity as determined by SDS-PAGE . The purified protein is typically stored as a lyophilized powder or in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability .
Studying ELIP distribution in thylakoid membranes requires a combination of membrane fractionation techniques and immunological detection methods. The most effective approach begins with careful isolation of intact thylakoid membranes from illuminated pea seedlings, followed by fractionation to separate grana and stroma thylakoids . This separation can be achieved using differential centrifugation with digitonin treatment, which selectively disrupts different regions of the thylakoid membrane system. For immunological detection, antibodies raised against bacterial-expressed fusion proteins containing ELIP sequences have proven highly specific and effective . Western blotting analysis comparing ELIP distribution to known marker proteins for photosystem I and photosystem II provides critical information about ELIP's association with specific photosynthetic complexes. Quantitative assessment using densitometry of Western blots allows determination of relative ELIP distribution, revealing that 60-70% of ELIP localizes to stroma thylakoids while 30-40% is present in grana thylakoids . For more detailed localization studies, immunogold electron microscopy can be employed to visualize ELIP distribution at ultrastructural levels. Additionally, membrane solubilization experiments using detergents like Triton X-100 followed by sucrose gradient centrifugation can reveal ELIP's association with specific protein complexes, providing further insights into its functional relationships within the thylakoid membrane system.
Experimentally assessing the functional relationship between ELIP and photoinhibition requires integrating molecular analyses with physiological measurements. A comprehensive approach should begin with controlled exposure of pea plants to varying light intensities (from 50 to 1000 μmol PAR m-2 s-1) and temperatures (4°C to 25°C) to induce different levels of photoinhibition . For each treatment condition, ELIP expression should be quantified at both transcript level (using qRT-PCR) and protein level (using Western blotting with specific antibodies). Simultaneously, photoinhibition should be assessed by measuring chlorophyll fluorescence parameters (Fv/Fm ratio) to determine PSII quantum efficiency, oxygen evolution rates to assess photosynthetic capacity, and D1 protein turnover rates as an indicator of PSII damage and repair . Mathematical correlation analyses between ELIP expression levels and photoinhibition parameters under various stress conditions can reveal whether ELIP abundance correlates positively with stress protection or negatively with photodamage. Additionally, transgenic approaches using RNAi or CRISPR-Cas9 to reduce or eliminate ELIP expression can provide direct evidence of ELIP's role in photoinhibition resistance. Complementary experiments using recombinant ELIP protein reconstituted with various pigments in liposome systems can help elucidate the molecular mechanisms through which ELIP might provide photoprotection, such as energy dissipation or reactive oxygen species scavenging capabilities.
Recombinant pea ELIP offers numerous potential applications for advancing our understanding of photosynthetic stress tolerance. The availability of purified recombinant ELIP protein (>90% purity) expressed in E. coli with an N-terminal His-tag allows for detailed biochemical and biophysical studies of protein-pigment interactions that are difficult to perform with native proteins . Researchers can use this recombinant protein to investigate ELIP's capacity to bind chlorophylls and carotenoids under controlled conditions, quantifying binding affinities and stoichiometries that may explain its photoprotective function. Reconstitution experiments incorporating recombinant ELIP into liposomes or isolated thylakoid membranes can assess its ability to confer stress tolerance directly to membrane systems exposed to high light, UV radiation, or other stresses. The recombinant protein also serves as an excellent tool for generating highly specific antibodies for immunolocalization studies, allowing precise tracking of ELIP distribution and abundance under various stress conditions. Additionally, structure-function studies using site-directed mutagenesis of the recombinant protein can identify critical amino acid residues involved in pigment binding, membrane integration, or interaction with other photosynthetic components. These approaches collectively offer a powerful toolkit for elucidating the molecular mechanisms through which ELIP contributes to photosynthetic stress tolerance, potentially informing strategies to enhance crop resilience to environmental challenges.
Advanced imaging and proteomics approaches offer transformative potential for understanding ELIP dynamics in photosynthetic membranes. Super-resolution microscopy techniques such as structured illumination microscopy (SIM), stimulated emission depletion (STED) microscopy, or photoactivated localization microscopy (PALM) could visualize ELIP distribution within thylakoid membranes at nanometer resolution, revealing previously undetectable patterns of protein organization during stress responses. Time-resolved fluorescence microscopy combined with fluorescently tagged ELIP variants could track the real-time movement and aggregation state of ELIP proteins in response to changing light conditions. For proteomics approaches, quantitative mass spectrometry using techniques like SILAC (stable isotope labeling with amino acids in cell culture) or TMT (tandem mass tag) labeling could provide comprehensive snapshots of ELIP abundance relative to thousands of other chloroplast proteins across different stress conditions and recovery phases. Crosslinking mass spectrometry (XL-MS) could identify ELIP interaction partners by capturing transient protein-protein interactions within the thylakoid membrane, helping to build interaction networks that explain ELIP's functional relationships. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) could reveal dynamic structural changes in ELIP under different conditions, while native mass spectrometry could characterize ELIP-pigment complexes. These advanced technologies would collectively provide unprecedented insights into how ELIP integrates into the dynamic proteome of stressed chloroplasts and how its interactions, modifications, and movements contribute to photoprotection mechanisms.
Studying ELIP in relation to climate change adaptation offers promising avenues for developing more resilient crop varieties. As climate change intensifies, crops will face more frequent exposure to combined stresses like high light, elevated temperatures, drought, and UV radiation – conditions known to influence ELIP expression and function . Understanding how ELIP contributes to stress tolerance under these combined stresses could inform targeted breeding or genetic engineering approaches. Comparative analyses of ELIP sequences, expression patterns, and functional properties between stress-tolerant and stress-sensitive crop varieties might reveal natural variation that correlates with adaptation capacity. Field studies examining ELIP expression in crops grown under variable climate conditions could identify environmental thresholds that trigger protective ELIP responses and determine whether these thresholds differ between traditional varieties and modern cultivars. Manipulating ELIP expression through genetic engineering could potentially enhance crop tolerance to climate-related stresses, particularly in regions experiencing increased UV radiation or temperature extremes. Additionally, the observation that CO2 levels influence ELIP expression under stress conditions suggests complex interactions between elevated atmospheric CO2 (a primary driver of climate change) and plant photoprotective mechanisms . Elucidating these interactions could help predict how rising CO2 levels might modify plant stress responses and identify strategies to optimize these interactions for improved crop performance under future climate scenarios. This research direction has significant implications for food security in a changing climate.