Recombinant Pisum sativum Inner membrane protein PPF-1, chloroplastic (PPF-1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Pisum sativum Inner Membrane Protein PPF-1, Chloroplastic (PPF-1) is a plant-derived protein involved in chloroplast membrane dynamics and senescence regulation. Originally identified in pea (Pisum sativum), PPF-1 exhibits homology to bacterial inner membrane proteins and plays critical roles in post-floral development and photosynthetic membrane stability . This recombinant form is engineered for research applications, enabling detailed biochemical and functional studies.

Functional Roles

PPF-1 performs dual roles in chloroplast biology:

  1. Membrane Protein Insertion: Facilitates the integration of integral membrane proteins into thylakoid membranes, supporting photosynthetic complex assembly .

  2. Senescence Inhibition: Post-floral expression in apical buds correlates with delayed senescence, particularly under short-day (SD) conditions .

Key Research Findings:

ConditionExpression PatternRegulatory FactorSource
SD-Grown G2 PeaSustained high expression in apical budsPhotoperiodic regulation
LD-Grown G2 PeaBrief post-floral expressionGibberellin A3 (GA3)
Transgenic ArabidopsisSuppresses senescence via TFL1 activationGA3-independent pathway

PPF-1’s expression is tightly regulated: GA3 treatment rescues senescence in LD-grown plants, while in day-neutral Alaska pea, its expression is negligible .

Expression and Regulation

PPF-1 is developmentally regulated, with tissue specificity and photoperiod-dependent expression:

  • Tissue Specificity: Exclusively expressed in apical buds post-floral initiation; absent in roots, stems, and mature leaves .

  • Photoperiod Sensitivity:

    • SD Conditions: High, sustained expression promotes indefinite vegetative growth.

    • LD Conditions: Transient expression, followed by senescence .

In transgenic Arabidopsis, PPF-1 overexpression delays cytosolic Ca²⁺ elevation, reducing programmed cell death in apical meristems .

Research Applications

PPF-1 serves as a model for studying:

  1. Chloroplast Membrane Dynamics: Insights into thylakoid protein insertion mechanisms .

  2. Senescence Regulation: Target for delaying crop maturity and improving yield .

Experimental Tools:

ApplicationMethodOutcomeSource
Membrane Protein StudiesRecombinant PPF-1 in thylakoid assaysElucidates insertion mechanisms
Senescence ModulationTransgenic plant modelsDelayed apical senescence

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific format requirements, kindly indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Please note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
PPF-1; Inner membrane protein PPF-1, chloroplastic; Post-floral-specific protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Pisum sativum (Garden pea)
Target Names
PPF-1
Target Protein Sequence
MAKTLISSPSFLGTPLPSLHRTFSPNRTRLFTKVQFSFHQLPPIQSVSHSVDLSGIFARA EGLLYTLADATVAADAAASTDVAAQKNGGWFGFISDGMEFVLKVLKDG
Uniprot No.

Target Background

Function
May be required for the insertion of certain integral membrane proteins into the chloroplast thylakoid membrane. May play a role in inhibiting senescence.
Protein Families
OXA1/ALB3/YidC (TC 2.A.9.2) family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in apical buds. Low levels of expression in leaves. Not expressed in roots, and stems.

Q&A

What is PPF-1 and what is its significance in plant biology?

PPF-1 (Post-Floral-specific Protein-1) is the first identified post-floral-specific gene from Pisum sativum. It was cloned from a cDNA library constructed from short-day (SD) grown G2 pea tissue using cDNA representational difference analysis (cDNA RDA). The significance of PPF-1 lies in its developmentally regulated expression pattern that appears only after floral initiation and is limited to apical buds, with non-detectable levels in roots, stems, and mature leaves . The protein contains five potential hydrophobic regions that are conserved with bacterial inner membrane proteins, suggesting it may function as a membrane-associated protein. Recent research indicates that PPF-1 encodes a putative calcium ion carrier that affects flowering time by modulating Ca²⁺ storage capacities in chloroplasts . This gene represents an important molecular component in the regulatory network controlling plant development after the transition to flowering, making it significant for understanding developmental processes in plants.

How does PPF-1 expression differ between short-day and long-day grown pea plants?

The expression patterns of PPF-1 show striking differences between short-day (SD) and long-day (LD) grown G2 pea plants. Under SD conditions, when G2 pea displays an unlimited growth habit, PPF-1 expression is sustained at a relatively high level long after floral initiation . This continuous expression correlates with the plant's ability to maintain vegetative growth despite flowering. In contrast, under LD conditions, when G2 pea undergoes apical senescence (similar to wild-type plants with genotype sn hr), PPF-1 is only expressed very briefly after flower initiation . This transient expression coincides with the initiation of programmed cell death processes in the apical buds under LD conditions, as evidenced by DNA fragmentation detection in senescing apical buds of LD-grown plants but not in non-senescing SD-grown counterparts . Interestingly, in day-neutral wild-type Alaska pea, PPF-1 expression is hardly detectable under any growth conditions, suggesting that the gene's expression is specifically regulated in the G2 pea variety in response to photoperiod .

What are the key experimental design factors to consider when studying PPF-1 expression?

When designing experiments to study PPF-1 expression, researchers should implement a robust Design of Experiments (DoE) approach to maximize information while minimizing resources. Several critical factors require careful consideration:

  • Photoperiod control: Since PPF-1 expression varies dramatically between short-day and long-day conditions, precise control of day length is essential. Researchers should maintain consistent light cycles (typically 8-10 hours for SD and 16+ hours for LD) in controlled growth chambers .

  • Developmental staging: Precise sampling at defined developmental stages is crucial because PPF-1 expression is tightly linked to post-floral development. Establish clear morphological markers for staging plants to ensure reproducibility .

  • Tissue specificity: Given that PPF-1 expression is limited to apical buds, proper tissue dissection techniques are essential to avoid dilution effects from non-expressing tissues .

  • Blocking and randomization: To account for environmental variations within growth chambers, implement a randomized block design where treatments are randomly assigned within blocks (shelves or sections of growth chambers) .

  • Technical replicates: Include sufficient biological and technical replicates (minimum n=3) to account for biological variability and to enable statistical validation .

  • Time-course sampling: Design time-course experiments capturing expression dynamics before, during, and after floral transition to document the complete expression pattern .

  • Controls: Include appropriate controls such as day-neutral Alaska pea varieties and both SD and LD growth conditions, even when studying only one condition, to validate expression patterns .

Following proper experimental design principles as outlined in formal DoE methodologies will help researchers develop predictive models of PPF-1 regulation while minimizing the required number of experiments .

How should researchers approach gibberellin treatment experiments to study PPF-1 expression?

When designing gibberellin treatment experiments to study PPF-1 expression, researchers should implement a factorial experimental design approach that addresses multiple variables simultaneously. The experimental design should consider:

  • Timing of application: Establish a series of gibberellin A3 (GA3) applications at precisely defined developmental stages, particularly focusing on pre-floral, floral transition, and post-floral stages. Previous research has shown that late application is ineffective at reversing apical senescence, so a time-course design is essential .

  • Concentration gradient: Implement a range of GA3 concentrations (typically 10⁻⁸ to 10⁻⁵ M) to establish dose-response relationships, as sensitivity may vary at different developmental stages .

  • Application method: Compare different application methods (foliar spray, apical application, soil drenching) to determine optimal delivery for consistent results.

  • Environmental interaction factors: Design the experiment to test interactions between GA3 treatment and environmental conditions (photoperiod, temperature) using a multi-factor design .

  • Temporal sampling strategy: Following GA3 application, implement a consistent sampling schedule (e.g., 6, 12, 24, 48, 72 hours post-treatment) to capture the dynamics of PPF-1 expression changes.

  • Control treatments: Include appropriate controls such as mock treatments with solvent only, and treatments with other hormones (e.g., auxin, cytokinin) to establish specificity of the GA3 effect .

  • Statistical power analysis: Calculate the minimum number of replicates needed to detect expected effect sizes based on preliminary data or literature values .

By following these guidelines and implementing proper randomization and blocking techniques, researchers can develop a robust experimental design that will yield statistically valid and biologically meaningful results regarding the relationship between gibberellin signaling and PPF-1 expression .

What molecular techniques are recommended for studying PPF-1 gene expression?

For comprehensive analysis of PPF-1 gene expression, researchers should employ multiple complementary molecular techniques:

  • Quantitative Real-Time PCR (qRT-PCR): This technique provides precise quantification of PPF-1 transcript levels. Design gene-specific primers spanning exon-exon junctions to avoid genomic DNA amplification. Normalize expression data using at least three reference genes that maintain stable expression across different treatments and developmental stages. Multiple reference genes improve normalization accuracy compared to using a single housekeeping gene.

  • Northern Blot Analysis: Though less sensitive than qRT-PCR, Northern blotting allows visualization of transcript size and integrity. This technique was successfully used in initial PPF-1 characterization studies to demonstrate the developmental and tissue-specific expression patterns . Use radioactively labeled PPF-1-specific probes for highest sensitivity.

  • RNA-Seq: For global transcriptome analysis, RNA-Seq provides comprehensive expression data. This approach is particularly valuable for identifying co-expressed genes that may function in the same pathway as PPF-1, potentially revealing regulatory networks.

  • In Situ Hybridization: To determine the precise cellular localization of PPF-1 transcripts within the apical bud, in situ hybridization with digoxigenin-labeled antisense RNA probes provides spatial resolution that other techniques cannot achieve.

  • Promoter-Reporter Fusions: Generating transgenic plants containing PPF-1 promoter fused to reporter genes like GUS or GFP allows visualization of promoter activity in vivo, providing insights into the developmental and environmental regulation of expression.

  • ChIP-Seq (Chromatin Immunoprecipitation followed by sequencing): To identify transcription factors that regulate PPF-1 expression, ChIP-Seq can be employed using antibodies against candidate transcription factors, particularly those involved in photoperiodic flowering and gibberellin signaling pathways.

Each technique offers distinct advantages, and combining multiple approaches provides the most comprehensive understanding of PPF-1 expression dynamics and regulation mechanisms.

What are the best methods for recombinant PPF-1 protein purification and functional characterization?

For successful purification and functional characterization of recombinant PPF-1 protein, researchers should implement the following methodological approach:

  • Expression System Selection: Given that PPF-1 is a plant membrane protein with hydrophobic regions similar to bacterial inner membrane proteins , select an appropriate expression system. For initial studies, bacterial systems like E. coli BL21(DE3) with specialized vectors (pET or pMAL) containing solubility-enhancing tags (MBP, SUMO, or TRX) can be used. For proper folding and post-translational modifications, consider plant-based expression systems such as Nicotiana benthamiana transient expression or stable transformation in Arabidopsis.

  • Purification Strategy:

    • For membrane proteins like PPF-1, implement a two-phase extraction protocol using mild detergents (DDM, LDAO, or CHAPS) to solubilize the protein while maintaining its native conformation.

    • Employ affinity chromatography (His-tag, GST-tag) for initial capture, followed by size exclusion chromatography to achieve high purity.

    • Consider using nanodiscs or liposome reconstitution to maintain the proper membrane environment during purification and subsequent functional studies.

  • Functional Characterization:

    • Calcium transport assays: Since PPF-1 is implicated as a calcium ion carrier , conduct liposome-based calcium flux assays using fluorescent calcium indicators (Fura-2, Fluo-4) to measure transport activity.

    • Electrophysiological methods: Implement patch-clamp techniques with reconstituted PPF-1 in artificial membranes to characterize ion selectivity and transport kinetics.

    • Binding assays: Perform isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to determine calcium binding affinities and stoichiometry.

    • Structural studies: Utilize circular dichroism (CD) spectroscopy to analyze secondary structure elements, and consider X-ray crystallography or cryo-EM for detailed structural analysis.

  • Validation Approaches:

    • Develop function-blocking antibodies against purified PPF-1 to inhibit activity in vitro.

    • Design site-directed mutagenesis of predicted functional domains to establish structure-function relationships.

    • Complement PPF-1 deficient plants with recombinant protein to confirm functionality in vivo.

By combining these methodological approaches, researchers can comprehensively characterize the biochemical and functional properties of recombinant PPF-1 protein, elucidating its role in calcium transport and chloroplast function.

How does PPF-1 potentially contribute to programmed cell death in plant apical meristems?

The relationship between PPF-1 and programmed cell death (PCD) in plant apical meristems represents a complex developmental regulatory mechanism. Research indicates that differential expression of PPF-1 correlates with the presence or absence of PCD markers in apical buds, suggesting a mechanistic connection between these processes . Several lines of evidence support PPF-1's role in PCD regulation:

  • Temporal correlation: DNA fragmentation, a hallmark of PCD, is detected in senescing apical buds of long-day (LD) grown G2 pea plants but is absent in non-senescing short-day (SD) grown counterparts . This pattern inversely correlates with PPF-1 expression, which is sustained in SD conditions but only transiently expressed in LD conditions .

  • Calcium signaling mechanism: As a putative calcium ion carrier that modulates Ca²⁺ storage in chloroplasts , PPF-1 may regulate cytosolic calcium concentrations, which are known second messengers in PCD signaling cascades. Sustained PPF-1 expression under SD conditions may maintain calcium homeostasis, preventing the calcium spikes that often trigger PCD pathways.

  • Inhibitor of caspase-activated DNase (ICAD) homologue detection: An animal ICAD homologue was detected continuously in SD-grown plants throughout development but only in early stages of LD-grown plants . This suggests a potential mechanism where PPF-1 expression might influence the stability or expression of PCD inhibitors like the ICAD homologue.

  • Gibberellin protection mechanism: GA3 treatment stimulates PPF-1 expression in LD conditions and coincidentally prevents apical senescence, suggesting that PPF-1 may mediate the protective effects of gibberellin against PCD.

The evidence indicates that PPF-1 likely functions as an inhibitor of PCD, either directly or indirectly, by maintaining cellular calcium homeostasis, influencing the expression of anti-apoptotic factors, or interacting with hormonal pathways that suppress senescence programs. This relationship positions PPF-1 as a central regulator in the developmental decision between continued meristem activity and terminal differentiation leading to senescence.

What is the relationship between PPF-1 and chloroplast function or development?

PPF-1's relationship with chloroplast function and development appears to be multifaceted, representing an important link between organelle biology and whole-plant development. Several aspects of this relationship can be elucidated based on current research:

  • Calcium homeostasis in chloroplasts: PPF-1 encodes a putative calcium ion carrier that modulates Ca²⁺ storage capacities in chloroplasts . Calcium serves as a critical second messenger in chloroplasts, regulating photosynthetic electron transport, carbon fixation enzymes, and stromal protein import. By controlling chloroplastic calcium levels, PPF-1 may influence multiple aspects of chloroplast function.

  • Potential parallels with REC genes: Research on the REDUCED CHLOROPLAST COVERAGE (REC) gene family in Arabidopsis, which establishes the proportion of cellular volume devoted to chloroplasts , may provide insights into PPF-1 function. While there is no direct evidence linking PPF-1 to the REC family, both affect organelle biology and may participate in similar regulatory networks governing organelle size and distribution.

  • Coordination of developmental transitions: The tight correlation between PPF-1 expression patterns and developmental transitions suggests it may coordinate chloroplast function with reproductive development. This coordination could involve:

    • Redirecting metabolic resources from chloroplasts to reproductive structures

    • Modulating photosynthetic capacity in response to developmental needs

    • Regulating retrograde signaling from chloroplasts to nucleus during developmental transitions

  • Energy metabolism regulation: Similar to how the FRIENDLY gene family helps regulate energy metabolism in cells containing both mitochondria and chloroplasts , PPF-1 may participate in balancing energy production between these organelles during the transition to flowering and subsequent developmental stages.

  • Photoperiodic signal integration: Given PPF-1's differential expression under different photoperiods , it may function at the intersection of light signaling, chloroplast function, and developmental regulation, potentially translating photoperiodic information into appropriate developmental responses via chloroplast-mediated mechanisms.

This relationship between PPF-1 and chloroplast biology represents an important area for future research, potentially revealing novel mechanisms coordinating organelle function with whole-plant development and environmental responses.

How can researchers ensure FAIR data principles when documenting PPF-1 research?

To ensure PPF-1 research data adheres to FAIR (Findable, Accessible, Interoperable, Reusable) principles, researchers should implement the following comprehensive approach:

  • Structured data documentation: Create detailed experimental data tables that contain all relevant metadata, including:

    • Precise genotype information of plant materials (accession numbers, genetic background)

    • Growth conditions with exact specifications (light intensity, photoperiod, temperature, humidity)

    • Sampling protocols with precise developmental staging criteria

    • Complete methodological descriptions including buffer compositions and instrument settings

  • Standardized vocabulary and ontologies: Employ standardized terminology from established plant ontologies (Plant Ontology, Gene Ontology) to describe:

    • Plant anatomical parts (e.g., "apical bud" rather than "shoot tip")

    • Developmental stages with precise definitions

    • Molecular functions and biological processes

  • Data identifiers and linking: Implement persistent identifiers for:

    • Experimental datasets (DOIs)

    • Biological materials (accession numbers)

    • Protocols (protocol.io identifiers)

    • Related publications (DOIs)

  • Comprehensive data deposition: Deposit complete datasets in appropriate repositories:

    • Sequence data in NCBI/ENA databases

    • Expression data in GEO or ArrayExpress

    • Proteomics data in PRIDE

    • Raw experimental data in institutional or domain repositories

  • Machine-readable formats: Structure data files in standardized formats:

    • Use CSV/TSV for tabular data rather than proprietary spreadsheet formats

    • Include machine-readable metadata headers

    • Separate raw data from processed data

  • Data processing transparency: Document all data transformations and statistical analyses:

    • Provide annotated scripts (R, Python) used for data processing

    • Include version information for all software used

    • Document statistical assumptions and tests performed

  • Data Management Plan: Develop a comprehensive plan that addresses:

    • Long-term storage solutions

    • Access control and sharing policies

    • Version control for datasets

    • Integration with existing databases

By implementing these practices, researchers studying PPF-1 can ensure their data meets FAIR principles, enhancing the reproducibility and impact of their research while enabling machine-readable access that facilitates data integration across studies.

What are the most promising future research directions for PPF-1 studies?

Based on current knowledge, several promising research directions for PPF-1 studies emerge that could significantly advance our understanding of plant development, organelle biology, and programmed cell death mechanisms:

  • Structural and functional characterization: Determining the three-dimensional structure of PPF-1 would provide crucial insights into its mechanism as a calcium ion carrier. Combining crystallography or cryo-EM approaches with site-directed mutagenesis could elucidate the calcium-binding domains and transport mechanism, clarifying how PPF-1 modulates chloroplastic calcium levels .

  • Regulatory network mapping: Implementing systems biology approaches to position PPF-1 within the broader flowering and senescence regulatory networks would reveal upstream regulators and downstream effectors. Techniques such as ChIP-seq for identifying transcription factors binding to the PPF-1 promoter and RNA-seq for identifying genes co-regulated with PPF-1 could illuminate these networks .

  • Calcium signaling dynamics: Developing real-time calcium imaging techniques in chloroplasts of PPF-1 mutants versus wild-type plants would provide direct evidence of PPF-1's role in calcium homeostasis. Such studies could employ genetically-encoded calcium indicators targeted to chloroplast compartments to visualize calcium flux dynamics during development and in response to environmental signals .

  • Evolutionary conservation analysis: Comparative genomics studies across diverse plant species could reveal the evolutionary history of PPF-1 and identify conserved functional domains. This approach might uncover related genes in other species and provide insights into the evolution of post-floral developmental mechanisms and programmed cell death regulation .

  • Translational applications: Exploring how manipulation of PPF-1 expression affects plant architecture, flowering duration, and senescence timing could lead to agricultural applications. Generating transgenic crop plants with modified PPF-1 expression might extend flowering periods, increase yield potential, or alter determinacy in crop species .

  • Integration with chloroplast biology: Investigating potential interactions between PPF-1 and the REDUCED CHLOROPLAST COVERAGE (REC) gene family could reveal novel mechanisms controlling organelle size and distribution during development . This could establish new paradigms for understanding how organelle biology is coordinated with whole-plant developmental transitions.

  • Cross-talk with programmed cell death pathways: Detailed characterization of the relationship between PPF-1 expression and PCD markers could identify molecular intermediates in this pathway. Particular focus on the animal inhibitor of caspase-activated DNase (ICAD) homologue detected in short-day grown plants could reveal conserved mechanisms between plant and animal PCD pathways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.