Recombinant Pisum sativum Photosystem II reaction center protein H (psbH)

Shipped with Ice Packs
In Stock

Description

2.1. Membrane Topology

PsbH is an intrinsic membrane protein with:

  • A single transmembrane helix (residues 10–30) .

  • An N-terminal stromal domain (critical for PSII dimer stability) .

  • A lumenal C-terminal domain .

Electron microscopy studies localize the N-terminus near the stromal surface of PSII, adjacent to the CP47 subunit .

2.2. Functional Insights

  • QB Site Regulation: PsbH stabilizes the QB-binding pocket on the D1 protein, influencing electron transfer from QA to QB .

  • Photoinhibition Resistance: Deletion or mutation of PsbH reduces tolerance to high-light stress by destabilizing PSII dynamics .

  • CP47 Accumulation: In Arabidopsis, PsbH is required for stable accumulation of the CP47 reaction center protein .

3.1. Expression and Isolation

  • Fusion Strategy: PsbH is expressed as a glutathione-S-transferase (GST) fusion protein in E. coli to enhance solubility .

  • Cleavage and Purification: GST tag removal via Factor Xa protease yields ~2.1 µg/mL of pure PsbH .

3.2. Biophysical Characterization

  • Secondary Structure: Circular dichroism (CD) spectroscopy confirms α-helical content (37%) matching transmembrane predictions .

  • NMR Analysis: 1H-15N HSQC spectra in β-D-octyl-glucopyranoside detergent reveal stable folding .

4.1. Antibody Development

Polyclonal antibodies against PsbH (e.g., Agrisera AS06 157) detect 4–7.7 kDa bands in plant extracts, aiding PSII assembly studies .

4.2. Mutagenesis Studies

  • Synechocystis Mutants: Truncations in PsbH’s N-terminus reduce charge recombination rates by 50%, indicating altered PSII core flexibility .

  • Nuclear Complementation: Nuclear-encoded PsbH rescues PSII defects in Arabidopsis hcf107 mutants, restoring photoautotrophy .

Comparative Analysis of PsbH Across Species

FeatureP. sativumCyanobacteriaArabidopsis
PhosphorylationAbsent Absent Present (Thr residues)
Gene LocationPlastid genome Plastid genome Nuclear genome
Molecular Weight7.7 kDa 7.0–9.9 kDa 7.7 kDa

Key Research Findings

  1. Light Stress Adaptation: PsbH-deficient PSII shows accelerated photodamage due to impaired QB site stability .

  2. CP47 Dependency: PsbH knockout reduces CP47 levels by 50%, suggesting structural interdependence .

  3. Evolutionary Conservation: PsbH’s transmembrane helix is conserved across oxygenic phototrophs, underscoring its functional essentiality .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbH; Photosystem II reaction center protein H; PSII-H; Photosystem II 10 kDa phosphoprotein; Photosystem II 9 kDa phosphoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-73
Protein Length
Full Length of Mature Protein
Species
Pisum sativum (Garden pea)
Target Names
psbH
Target Protein Sequence
ATQTVENSSRSGPRRTAVGDLLKPLNSEYGKVAPGWGTTPLMGIAMALFAVFLSIILEIY NSSLLLDQISMN
Uniprot No.

Target Background

Function
Photosystem II (PSII) reaction center protein H (psbH) is a crucial component of the core complex in PSII, essential for its stability and/or assembly. PSII acts as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H2O, producing O2 and a proton gradient that drives ATP formation. It comprises a core antenna complex responsible for capturing photons and an electron transfer chain converting photonic excitation into charge separation.
Protein Families
PsbH family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.