Recombinant Pisum sativum Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Herbicide Binding Studies

Recombinant PsbA enables molecular docking and free energy calculations to evaluate herbicide interactions:

  • Key Herbicides Tested: Diuron, terbuthylazine, metribuzin, bentazon .

  • Findings:

    • Diuron and terbuthylazine show 10x higher binding affinity than bentazon .

    • Hydrogen bonding with His215 and hydrophobic interactions with Phe265 dominate herbicide binding .

PSII Assembly and Repair Mechanisms

Studies using recombinant PsbA highlight its role in PSII biogenesis:

  • C-terminal Processing: CtpA2 protease is essential for cleaving the C-terminal extension of nascent D1 during de novo PSII assembly .

  • Photoinhibition: Mutants with impaired PsbA processing exhibit accelerated D1 turnover under high light, reducing PSII stability .

Evolutionary Conservation

Structural comparisons reveal 90% sequence similarity in the QB site between Pisum sativum and cyanobacterial D1 proteins, underscoring its conserved role in electron transport .

Challenges and Future Directions

  • Stability Issues: Recombinant PsbA tends to aggregate without detergents or glycerol .

  • Applications: Serves as a template for designing next-generation herbicides with reduced environmental impact .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference for your own protocols.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; pgiI; Photosystem II protein D1; PSII D1 protein; 32 kDa thylakoid membrane protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Pisum sativum (Garden pea)
Target Names
psbA
Target Protein Sequence
TAILERRDSENLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
This protein is one of the two reaction center proteins of photosystem II. Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein in Pisum sativum and what is its role in photosynthesis?

The Q(B) binding site is located in the D1 region formed by the D and E α-helices and the DE connecting loop, spanning from approximately Phe211 to Leu275 in eukaryotes. Several hydrophobic amino acids, including Phe211, Leu218, Phe255, Phe265, Leu271, Phe274, and Leu275, form the pocket that accommodates the apolar head and tail of the plastoquinone molecule . The polar groups of His215 and/or Ser264 or Phe265 form hydrogen bonds with the keto-oxygens of the plastoquinone head at the bottom of the Q(B) pocket .

How conserved is the D1 protein and Q(B) binding site across different photosynthetic organisms?

The D1 protein displays remarkable conservation across diverse photosynthetic organisms, from cyanobacteria to algae and higher plants. Sequence alignment analysis shows high conservation among the D1 protein sequences of algae and plants compared to cyanobacterial counterparts, with similarity percentages ranging from 92.3% to 94.8% . Specifically, Chlamydomonas reinhardtii shows 92.3% similarity, while Pisum sativum demonstrates 94.8% similarity to the cyanobacterial (Thermosynecococcus elongatus) D1 protein .

The Q(B) binding site is particularly well-conserved. The amino acids that form the hydrophobic pocket for plastoquinone binding, including Phe211, Leu218, Phe255, Phe265, Leu271, Phe274, and Leu275, are highly conserved among cyanobacteria, algae, and plants . Additionally, the amino acids involved in forming hydrogen bonds with the plastoquinone head, such as His215 and Ser264 or Phe265, are also conserved. This high level of conservation suggests that the Q(B) site functionality has been maintained throughout the evolution of oxygenic photosynthetic organisms and explains why herbicides targeting this site can be effective across a wide range of plant species.

What expression systems are recommended for producing recombinant Photosystem Q(B) protein?

Multiple expression systems can be utilized for producing recombinant Photosystem Q(B) protein (psbA1), each with distinct advantages depending on research requirements. Escherichia coli and yeast expression systems offer the best protein yields and shorter production turnaround times, making them particularly suitable for high-throughput studies or when large quantities of protein are needed .

For research requiring properly folded and functionally active proteins, insect cells with baculovirus expression systems or mammalian cells provide significant advantages. These eukaryotic expression systems can perform many of the post-translational modifications necessary for correct protein folding and activity maintenance . The choice between these systems ultimately depends on the specific research objectives, whether prioritizing quantity, functional activity, or structural integrity of the recombinant protein.

When selecting an expression system, researchers should consider whether their studies focus on structural analysis, binding assays, or functional characterization, as these different applications may have varying requirements for protein quality and modification state.

How do different herbicides interact with the Q(B) binding site in Pisum sativum, and what molecular features determine their binding affinity?

Different herbicides exhibit varied interaction patterns and binding affinities with the Q(B) site of the D1 protein in Pisum sativum. Molecular docking studies combined with experimental approaches have revealed specific binding mechanisms for several PSII-inhibiting herbicides.

Diuron, terbuthylazine, and metribuzin demonstrate the highest affinity for the D1 Q(B) site, with diuron and metribuzin forming hydrogen bonds with His215 . This interaction is particularly significant as His215 is one of the key residues normally involved in binding the native plastoquinone molecule. The formation of these hydrogen bonds likely contributes to their high binding affinity and efficient PSII inhibition.

In contrast, bentazon shows the lowest PSII inhibitory effect and lacks specificity for the Q(B) site . Metobromuron exhibits an intermediate binding behavior. These differences in binding affinity are reflected in the I₅₀ values (concentration causing 50% inhibition) determined through both photochemical and fluorescence assays. The I₅₀ values for diuron, terbuthylazine, and metribuzin are approximately one order of magnitude lower than those for bentazon and metobromuron, indicating their higher potency as PSII inhibitors .

Each herbicide displays a specific molecular interaction pattern within the Q(B) site that extends beyond their chemical classification. These distinctive interaction patterns suggest that the binding affinity is determined by the specific molecular architecture of each compound rather than solely by the chemical class to which it belongs.

What methodologies are most effective for studying the inhibitory effects of herbicides on the Q(B) binding site?

Two complementary methodological approaches have proven particularly effective for studying herbicide interactions with the Q(B) binding site: experimental biophysical techniques and computational molecular docking.

For experimental assessment, two primary methods are widely employed:

  • DPIP Photoreduction Assay: This photochemical assay measures PSII activity as an electron transfer rate from water to the "Hill oxidant" DPIP (2,6-dichlorophenolindophenol), which accepts electrons from the Q(B) site during light-induced water oxidation . By measuring the rate of DPIP reduction spectrophotometrically in the presence of various herbicide concentrations, researchers can determine inhibition curves and I₅₀ values.

  • OJIP Chlorophyll Fluorescence Kinetics: This non-invasive technique measures chlorophyll fluorescence transients, providing insights into electron transfer efficiency within PSII. The relative variable fluorescence at the J step (V<sub>j</sub>) represents the relative amount of reduced Q(A) and can detect herbicide interference with electron transport from Q(A) to Q(B) . Changes in the slope and shape of the fluorescence emission curve, particularly alterations in the J peak, indicate herbicide binding.

These experimental approaches can be complemented by computational molecular docking, which provides atomic-level insights into herbicide binding. Using high-resolution PSII structures, molecular docking can predict the binding poses, interaction energies, and specific amino acid interactions of herbicides within the Q(B) pocket . The combination of these experimental and computational approaches allows for a comprehensive understanding of herbicide binding mechanisms and the development of structure-activity relationships.

How do mutations in the D1 protein affect herbicide binding and resistance in the Q(B) site?

Mutations in the D1 protein, particularly those within or near the Q(B) binding pocket, can significantly alter herbicide binding affinity and lead to herbicide resistance. Several key amino acid residues have been identified as critical for herbicide sensitivity.

The amino acids that form the hydrophobic pocket (Phe211, Leu218, Phe255, Phe265, Leu271, Phe274, and Leu275) and those involved in hydrogen bonding (His215, Ser264) are particularly important determinants of herbicide binding . Mutations in these residues can disrupt the shape complementarity between herbicides and the Q(B) pocket or eliminate crucial hydrogen bonding interactions.

For instance, the highly conserved His215 forms hydrogen bonds with both the native plastoquinone and with herbicides like diuron and metribuzin . Mutations affecting this residue could potentially disrupt these interactions, leading to decreased herbicide binding and resistance. Similarly, modifications to the hydrophobic residues that accommodate the apolar portions of herbicides could alter the pocket architecture and reduce binding affinity.

Understanding these structure-function relationships is essential for predicting the development of herbicide resistance and designing more effective and selective herbicides. By targeting highly conserved regions that are less likely to tolerate mutations without compromising PSII function, researchers may develop herbicides that are less prone to resistance development.

What protocols can be used to assess the inhibitory effects of herbicides on the Photosystem Q(B) protein?

Researchers can employ several complementary protocols to assess herbicide inhibitory effects on the Photosystem Q(B) protein, each providing unique insights into different aspects of PSII inhibition.

DPIP Photoreduction Assay Protocol:

  • Isolate thylakoid membranes from plant tissue (e.g., Pisum sativum leaves)

  • Suspend thylakoids in reaction buffer containing DPIP as an electron acceptor

  • Add herbicides at various concentrations

  • Illuminate samples with saturating light

  • Measure DPIP reduction spectrophotometrically at 600 nm over time

  • Calculate the rate of DPIP reduction and determine inhibition percentages

  • Plot inhibition curves and calculate I₅₀ values

OJIP Chlorophyll Fluorescence Protocol:

  • Dark-adapt leaf samples for 30 minutes

  • Treat with various herbicide concentrations

  • Measure chlorophyll fluorescence using a fluorometer with a saturating light pulse

  • Record the OJIP transient curves (O represents minimal fluorescence F₀, J and I are intermediate steps, P represents maximum fluorescence F<sub>M</sub>)

  • Calculate the relative variable fluorescence at the J step: V<sub>j</sub> = (F<sub>2ms</sub> - F₀)/(F<sub>M</sub> - F₀)

  • Determine 1-V<sub>j</sub> values at various herbicide concentrations

  • Plot inhibition curves and calculate I₅₀ values

Computational Molecular Docking Protocol:

  • Obtain or model the 3D structure of plant D1 protein with the Q(B) binding site

  • Prepare herbicide molecules for docking

  • Define the Q(B) binding site as the docking target

  • Perform molecular docking simulations

  • Analyze docking poses and binding energies

  • Identify key amino acid interactions

  • Validate computational predictions with experimental data

The combination of these methods provides a comprehensive assessment of herbicide inhibitory effects, from molecular interactions to functional consequences on electron transport.

What are the optimal conditions for expressing and purifying recombinant Pisum sativum Photosystem Q(B) protein?

The optimal conditions for expressing and purifying recombinant Pisum sativum Photosystem Q(B) protein depend on the expression system chosen and the intended research application.

Expression Systems and Conditions:

  • E. coli Expression System:

    • Use BL21(DE3) or similar strain optimized for protein expression

    • Clone the psbA gene into an expression vector with an appropriate promoter (e.g., T7)

    • Include affinity tags (His-tag or GST-tag) for purification

    • Induce expression at lower temperatures (16-20°C) to enhance proper folding

    • Consider using specialized E. coli strains for membrane protein expression

    • Optimize codon usage for prokaryotic expression

  • Yeast Expression System:

    • Pichia pastoris or Saccharomyces cerevisiae systems are recommended

    • Use strong inducible promoters (e.g., AOX1 for P. pastoris)

    • Include secretion signals if appropriate

    • Culture at 28-30°C with methanol induction (for P. pastoris)

    • Provide appropriate carbon sources and maintain proper aeration

  • Insect Cell/Baculovirus System:

    • Use Sf9 or High Five insect cells

    • Clone psbA gene into baculovirus transfer vector

    • Generate recombinant baculovirus

    • Infect cells at optimal MOI (multiplicity of infection)

    • Harvest 48-72 hours post-infection

    • Maintain cells at 27°C during expression

Purification Strategy:

  • Cell lysis under conditions that maintain protein stability

  • Membrane fraction isolation through differential centrifugation

  • Detergent solubilization (e.g., α-DDM, β-DDM, or LDAO)

  • Affinity chromatography using the incorporated affinity tag

  • Size exclusion chromatography for further purification

  • Maintain appropriate buffers containing stabilizing agents throughout

The choice between expression systems should be guided by research requirements. E. coli and yeast systems provide higher yields and faster production times, while insect and mammalian cell systems offer superior post-translational modifications necessary for proper folding and activity .

How can molecular docking be combined with experimental approaches to validate findings on herbicide binding?

An integrated approach combining molecular docking with experimental validation provides the most robust understanding of herbicide binding to the Photosystem Q(B) protein. The following methodology represents an effective workflow for such studies:

  • Initial Molecular Docking:

    • Perform molecular docking of herbicides into the Q(B) binding site using high-resolution crystal structures

    • Generate binding poses and calculate binding energies

    • Identify key amino acid residues predicted to interact with herbicides

    • Rank herbicides based on predicted binding affinities

  • Experimental Validation:

    • Conduct DPIP photoreduction assays to determine I₅₀ values for herbicides

    • Perform OJIP chlorophyll fluorescence measurements to assess PSII inhibition

    • Compare experimental I₅₀ rankings with computational binding energy predictions

    • Verify that herbicides with stronger predicted binding show lower I₅₀ values

  • Structure-Activity Relationship Development:

    • Correlate molecular features of herbicides with binding affinities

    • Identify pharmacophores essential for high-affinity binding

    • Determine which structural elements contribute to specificity

  • Validation Through Mutagenesis:

    • Design site-directed mutagenesis experiments targeting residues predicted to be important for herbicide binding

    • Express and purify mutant proteins

    • Assess herbicide binding and inhibitory effects with mutants

    • Confirm the role of specific amino acids in herbicide interactions

  • Refinement of Computational Models:

    • Use experimental data to refine docking parameters

    • Implement molecular dynamics simulations to account for protein flexibility

    • Develop more accurate scoring functions based on experimental correlations

This iterative approach, alternating between computational prediction and experimental validation, has proven effective in elucidating the binding mechanisms of various herbicides to the Q(B) site. For instance, studies combining these approaches have revealed that diuron, metribuzin, and terbuthylazine have significantly higher affinities for the Q(B) site compared to bentazon, with the former forming specific hydrogen bonds with key residues like His215 .

Comparative Herbicide Binding Affinities to Pisum sativum PSII

The following table summarizes the inhibitory effects of various herbicides on Pisum sativum PSII as determined by two complementary experimental approaches:

HerbicideChemical ClassI₅₀ (DPIP Photoreduction)I₅₀ (OJIP Fluorescence)Key Interaction ResiduesHydrogen Bonding
DiuronPhenylureaLow (high affinity)Low (high affinity)His215, hydrophobic pocketForms H-bonds with His215
TerbuthylazineTriazineLow (high affinity)Low (high affinity)Hydrophobic pocketStrong binding
MetribuzinTriazinoneLow (high affinity)Low (high affinity)His215, hydrophobic pocketForms H-bonds with His215
MetobromuronPhenylureaIntermediateIntermediatePartial interactionIntermediate specificity
BentazonBenzothiadiazoleHigh (low affinity)High (low affinity)Non-specific bindingLacks specificity for Q(B) site

This comparative analysis demonstrates that despite belonging to different chemical classes, herbicides can exhibit similar binding affinities based on their specific molecular interaction patterns with the Q(B) site . Diuron, terbuthylazine, and metribuzin show approximately one order of magnitude higher affinity compared to bentazon, while metobromuron exhibits intermediate behavior.

Structural Conservation of Key Amino Acids in the D1 Protein Q(B) Binding Site

The following table highlights the conservation of critical amino acid residues in the Q(B) binding site across different photosynthetic organisms:

Amino Acid PositionPisum sativumSpinacia oleraceaArabidopsis thalianaChlamydomonas reinhardtiiThermosynecococcus elongatusFunction in Q(B) Binding
Phe211ConservedConservedConservedConservedConservedForms hydrophobic pocket
His215ConservedConservedConservedConservedConservedH-bonds with PQ and herbicides
Leu218ConservedConservedConservedConservedConservedForms hydrophobic pocket
Phe255ConservedConservedConservedConservedConservedForms hydrophobic pocket
Ser264ConservedConservedConservedConservedConservedPotential H-bonding
Phe265ConservedConservedConservedConservedConservedForms hydrophobic pocket
His272ConservedConservedConservedConservedConservedCoordinates non-heme iron
Leu275ConservedConservedConservedConservedConservedForms hydrophobic pocket

The high degree of conservation across these organisms, ranging from 92.3% to 94.8% similarity compared to the cyanobacterial counterpart, underscores the evolutionary importance of the Q(B) binding site structure and function . This conservation explains why herbicides targeting this site can be effective across various plant species and suggests that these residues are critical for PSII function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.