Recombinant Pisum sativum Protein TIC 40, chloroplastic (TIC40)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TIC40; Protein TIC 40, chloroplastic; Translocon at the inner envelope membrane of chloroplasts 40; PsTIC40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
73-436
Protein Length
Full Length of Mature Protein
Species
Pisum sativum (Garden pea)
Target Names
TIC40
Target Protein Sequence
SISSSNGQETTSVGVSPQLSPPPPSTVGSPLFWIGIGVGFSALFSVVASRVKKYAMQQAF KSMMGQMNTQNNPFDSGAFSSGPPFPFPMPSASGPATPAGFAGNQSQATSTRSASQSTVT VDIPATKVEAAAPAPDINVKEEVEVKNEPKKSAFVDVSPEETVQKNAFERFKDVDESSSF KEARAPAEASQNGTPFKQGFGDSPSSPSERKSALSVDALEKMMEDPTVQQMVYPYLPEEM RNPSTFKWMMQNPEYRQQLEAMLNNMGGGTEWDSRMMDTLKNFDLNSPDVKQQFDQIGLS PQEVISKIMANPDVAMAFQNPRVQAAIMDCSQNPMSIVKYQNDKEVMDVFNKISELFPGV SGPP
Uniprot No.

Target Background

Function
Recombinant Pisum sativum Protein TIC40, chloroplastic (TIC40), is involved in protein precursor import into chloroplasts. It functions as part of a motor complex comprising a co-chaperone (TIC40) and a chaperone (HSP93) associated with the import channel (TIC110). TIC40 facilitates the release of bound transit peptides from TIC110 and stimulates ATP hydrolysis by HSP93. It also participates in the reinsertion of proteins from the chloroplast stroma into the inner membrane.
Subcellular Location
Plastid, chloroplast inner membrane; Single-pass membrane protein.

Q&A

What is TIC40 and what is its role in chloroplasts?

TIC40 is an inner envelope membrane protein with a large hydrophilic domain located in the stroma of chloroplasts. It functions as a critical component of the chloroplast protein import machinery, specifically as part of the translocon at the inner envelope membrane of chloroplasts (TIC). TIC40 acts as a co-chaperone in the stromal chaperone complex that facilitates protein translocation across the inner membrane into the stroma . Studies with Arabidopsis mutants have shown that TIC40 is essential for efficient protein import, as chloroplasts lacking TIC40 show reduced rates of precursor protein translocation .

What expression systems are most effective for recombinant TIC40 production?

E. coli is the most commonly used expression system for recombinant TIC40 production. For full-length mature protein (residues 73-436), the protein can be expressed with an N-terminal His-tag for easier purification . When expressing TIC40, researchers should be aware that the protein tends to migrate more slowly on SDS-PAGE than predicted based on its molecular mass, likely due to its high proline content (approximately 11%) . This migration anomaly should be considered when verifying expression and purification results.

For functional studies, researchers often express versions of TIC40 without the transmembrane region (designated as TIC40s), which retain the co-chaperone signature domains and exhibit functionality in various assays .

What are the optimal conditions for purification and storage of recombinant TIC40?

For purification of His-tagged recombinant TIC40:

  • Use affinity chromatography with Ni-NTA or similar matrices

  • Follow with size-exclusion chromatography for higher purity

  • For storage, lyophilization is appropriate with Tris/PBS-based buffer containing 6% trehalose at pH 8.0

Storage recommendations:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple uses to avoid repeated freeze-thaw cycles

  • For working aliquots, store at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

How can researchers assess TIC40's role in protein import experimentally?

To assess TIC40's role in chloroplast protein import, researchers can employ several complementary approaches:

  • Comparative import assays using wildtype and mutant chloroplasts:

    • Isolate chloroplasts from wildtype plants and tic40 mutants

    • Incubate with radiolabeled precursor proteins

    • Compare import rates by analyzing protein translocation at different time points

    • Quantify the amount of processed mature protein as a measure of import efficiency

  • Analysis of intermediate stages during import:

    • Perform time-course experiments with energy-depleted chloroplasts

    • Analyze binding versus translocation steps separately

    • Use cross-linking reagents to capture transient interactions during import

  • Interaction analysis with other translocon components:

    • Use chemical cross-linkers such as dithiobis(succinimidylpropionate) (DSP) on intact chloroplasts

    • Isolate membranes and solubilize with detergent

    • Perform co-immunoprecipitation with anti-TIC40 antibodies

    • Analyze by immunoblotting for associated proteins (TIC110, TOC75, Hsp93)

What are the best approaches to study TIC40 complex formation?

Several complementary techniques can be used to study TIC40 complex formation:

  • Size-exclusion chromatography combined with immunoblotting:

    • Apply protein samples to gel filtration columns

    • Collect fractions and analyze by immunoblotting

    • Determine the elution profile of TIC40 and estimate complex sizes

  • Blue native gel electrophoresis:

    • Separate native protein complexes based on size

    • Visualize using standard immunoblotting techniques

    • Identify different TIC40-containing complexes

  • Affinity pull-down assays:

    • Use differently tagged versions of TIC40 (e.g., His-tagged and GST-tagged)

    • Perform pull-down experiments to assess self-interaction

    • Analyze by SDS-PAGE and immunoblotting

  • Dynamic light scattering (DLS):

    • Prepare purified recombinant TIC40 at 10 mg/ml in phosphate buffer

    • Perform measurements at different temperatures (4, 16, 24, and 40°C)

    • Analyze size distribution to detect complex formation

What methods are effective for analyzing TIC40 secondary structure?

Circular dichroism (CD) spectroscopy is particularly effective for analyzing TIC40 secondary structure:

  • CD spectroscopy protocol:

    • Prepare purified TIC40 at concentrations of 0.1-0.3 mg/ml in 10 mM Na₂PO₄ (pH 7.0)

    • Perform multiple scans at 25°C using a 0.1 mm path length cuvette

    • Correct baseline by subtracting spectra of buffer alone

    • Calculate secondary structure percentages using appropriate software (e.g., CDNN)

  • Complementary approaches:

    • Protein crystallography (challenging due to membrane association)

    • NMR spectroscopy for specific domains

    • In silico structure prediction, particularly for the TPR and co-chaperone domains

    • Limited proteolysis to identify stable structural domains

How can researchers investigate the transmembrane topology of TIC40?

To investigate the transmembrane topology of TIC40, researchers can employ several approaches:

  • Protease protection assays:

    • Treat isolated chloroplasts with different concentrations of trypsin

    • Trypsin can penetrate the outer membrane but not the inner membrane

    • Compare degradation patterns of TIC40 with known marker proteins

    • Resistance to trypsin indicates stromal localization of the hydrophilic domain

  • Immunogold electron microscopy:

    • Use specific antibodies against different domains of TIC40

    • Visualize the localization within the chloroplast envelope

    • Determine the orientation of different domains relative to the membrane

  • Fluorescent protein fusions:

    • Create fusion proteins with GFP attached to different domains

    • Express in plant cells and analyze localization patterns

    • Use confocal microscopy to determine membrane topology

How does TIC40 interact with the chloroplast protein import machinery?

TIC40 shows specific interactions with key components of the chloroplast protein import machinery:

These interactions place TIC40 at a critical junction of the import process, where it likely facilitates the handover of precursor proteins from the translocation channel to the stromal chaperone system.

What is the mechanism of TIC40's co-chaperone function?

The mechanism of TIC40's co-chaperone function involves several coordinated activities:

  • Transit peptide release from TIC110:

    • TIC40 is recruited by TIC110 during protein import

    • It stimulates the release of transit peptides from TIC110

    • This facilitates the forward movement of precursors through the import machinery

  • ATP hydrolysis stimulation:

    • When associated with Hsp93, TIC40 stimulates ATP hydrolysis

    • This provides energy for precursor translocation across the inner membrane

    • The stimulation is likely mediated through the co-chaperone domain

  • Complex formation and regulation:

    • TIC40 can form various complexes, including self-association

    • The formation of these complexes may be regulated by environmental conditions

    • Different forms of TIC40 (40 and 31 kDa) may have distinct roles in complex assembly

The structural basis for these activities lies in TIC40's C-terminal domains, which contain a TPR domain followed by a region with similarity to co-chaperones Hip and Hop.

What are common problems in recombinant TIC40 expression and how can they be addressed?

Several challenges may arise during recombinant TIC40 expression:

  • Protein solubility issues:

    • Problem: The transmembrane domain of full-length TIC40 can cause aggregation

    • Solution: Express truncated versions without the transmembrane region (TIC40s)

    • Alternative: Optimize expression conditions (temperature, induction time, expression strain)

  • Purification challenges:

    • Problem: Multiple forms of TIC40 often appear during expression (40 and 31 kDa forms)

    • Solution: The 31 kDa form arises from a downstream start site

    • Approach: Use size-exclusion chromatography to separate different forms if needed

  • Protein stability concerns:

    • Problem: Recombinant TIC40 may degrade during storage

    • Solution: Add 5-50% glycerol to the storage buffer

    • Recommendation: Aliquot and avoid repeated freeze-thaw cycles

How can researchers verify the functionality of recombinant TIC40 protein?

To verify the functionality of recombinant TIC40 protein, researchers can:

  • Assess co-chaperone activity:

    • Measure stimulation of Hsp93 ATPase activity

    • Compare wildtype TIC40 with mutated versions in key functional domains

  • Test for complex formation:

    • Perform size-exclusion chromatography to detect self-association

    • Use different tagged versions (His-tag and GST-tag) to confirm interaction

    • Expected results: Recombinant TIC40s proteins form complexes with estimated molecular masses around 66-180 kDa as detected by gel filtration

  • Perform complementation assays:

    • Attempt to rescue tic40 mutant phenotypes by expressing recombinant protein

    • Measure import rates in isolated chloroplasts with added recombinant TIC40

  • Binding assays with partner proteins:

    • Test direct interaction with recombinant TIC110 and Hsp93

    • Use surface plasmon resonance or similar techniques to measure binding affinities

What are unresolved questions about TIC40's role in chloroplast protein import?

Several important questions remain unresolved:

  • Regulatory mechanisms:

    • How is TIC40's activity regulated during different developmental stages?

    • Does post-translational modification affect TIC40 function?

    • What signals modulate TIC40 complex formation?

  • Substrate specificity:

    • Does TIC40 play different roles for different classes of precursor proteins?

    • Is it involved in alternative import pathways?

    • How does it recognize or interact with transit peptides?

  • Evolutionary aspects:

    • How conserved is TIC40 function across different plant species?

    • What is the evolutionary relationship between TIC40 and other co-chaperones?

    • How did the TIC40-dependent import pathway evolve?

What emerging techniques might advance our understanding of TIC40 function?

Several emerging techniques could significantly advance TIC40 research:

  • Cryo-electron microscopy:

    • Could provide high-resolution structures of TIC40 in the context of the entire translocon complex

    • May reveal conformational changes during protein import

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to study dynamic interactions

    • Optical tweezers to measure forces during protein translocation

    • Could provide insights into the kinetics of TIC40-mediated steps

  • Synthetic biology approaches:

    • Engineering minimal chloroplast import systems

    • Creating artificial TIC40 variants with novel functions

    • Developing biosensors to monitor TIC40 activity in vivo

  • Systems biology integration:

    • Proteomics to identify the complete set of TIC40 interactors

    • Transcriptomics to understand co-regulation with other import components

    • Metabolomics to link import efficiency with chloroplast metabolism

How does TIC40 structure and function compare between different plant species?

While most detailed studies have been conducted on Pisum sativum (pea) and Arabidopsis thaliana TIC40 proteins, comparisons reveal:

  • Structural conservation:

    • The domain organization (transmembrane domain, TPR domain, co-chaperone domain) is conserved across species

    • The pea TIC40 shows similar membrane topology to Arabidopsis TIC40, with the bulk of its polypeptide located in the stroma

  • Functional differences:

    • Arabidopsis null mutants of atTIC40 show a pale green phenotype but are not seedling lethal, suggesting some plasticity in the requirement for TIC40

    • Species-specific variations in TIC40 sequence may reflect adaptations to different environmental conditions or import requirements

  • Expression patterns:

    • TIC40 expression levels may vary between species and tissue types

    • This could reflect differential needs for protein import capacity

A detailed comparison table of TIC40 properties across species would require additional data not provided in the search results.

Can insights from Pisum sativum TIC40 be applied to crop improvement?

Potential applications of TIC40 research to crop improvement include:

  • Engineering enhanced protein import efficiency:

    • Modifying TIC40 expression levels might enhance chloroplast development

    • This could potentially improve photosynthetic efficiency and yield

  • Stress tolerance applications:

    • Understanding how TIC40 responds to stress conditions could lead to crops with improved resilience

    • Engineering TIC40 variants with enhanced stability under stress conditions

  • Protein targeting applications:

    • Improved understanding of the import machinery could enable better targeting of recombinant proteins to chloroplasts

    • This has applications in metabolic engineering and molecular farming

The research-based nature of these applications highlights the potential translational value of fundamental TIC40 studies, though significant additional research would be required before practical implementation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.