Recombinant Pisum sativum Protein TIC 55, chloroplastic (TIC55)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TIC55; Protein TIC 55, chloroplastic; Rieske iron-sulfur protein TIC55; Translocon at the inner envelope membrane of chloroplasts 55; PsTIC55
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
61-553
Protein Length
full length protein
Species
Pisum sativum (Garden pea)
Target Names
TIC55
Target Protein Sequence
AADVKDATLLDGEEDQKVLVGPSSEQERKGEREVADYDWTEEWYPLYLTKNVPHDAPLGL KVYDKNIVLFRDGNDQFQCYEDRCPHRLAKLSEGQLIDGRLECLYHGWQFEGEGKCVKIP QLPADAKIPKSACVKTYEVRDSQGVLWVWMSRKTPPNVSKIPWFENFARPGFQDISTTHE LPYDHSILLENLMDPAHVPISHDRTDWSAKREDAQALGFEVTERTDRGFAGWWGREKDGS KPNFLRFEAPCVLQNNREIVDKNGEINHFSGLFLCRPTGQGKSMLIVRFGATKRSPLIKL FPEWYFHQNASKVFEQDMGFLSSQNEILLKEKVPTKELYLNLKSSDTWVAEYRKWMDKVG HGMPYHFGHSTISLPEEPAVVEHAPAGLVAGLSASSPAKGGIGTMHAPNLANRYFRHVIH CKGCSSAIKAFQIWKNVLSGVVVALAALAILVSGRQWKVLLLASASLCSVGVYACSTAIA MNTTNFIRVHRRL
Uniprot No.

Target Background

Function

Recombinant Pisum sativum Protein TIC55 (chloroplastic) is involved in the import of protein precursors into chloroplasts. It is a component of the redox regulon, which also includes TIC32, TIC55, and TIC62.

Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and functional domains of TIC55 protein?

TIC55 is a 55 kDa protein located in the chloroplast inner envelope membrane. The protein contains several key structural elements that contribute to its function:

  • A Rieske-type iron-sulfur center located at amino acid positions 142-175

  • A mononuclear iron-binding site at positions 248-264

  • Two membrane-spanning α-helices at the C-terminus that anchor the protein to the chloroplastic inner envelope membrane

  • The N-terminal portion likely consists of amphiphilic β-sheets

The protein is synthesized as a larger precursor containing a transit peptide of approximately 60 amino acids that facilitates import into chloroplasts. This transit peptide is cleaved during maturation, resulting in the functional 55 kDa protein .

How does TIC55 participate in protein import into chloroplasts?

TIC55 functions as a component of the Translocon at the Inner envelope membrane of Chloroplasts (Tic) complex. The original research in pea plants suggested that TIC55 played an essential role in protein import through its redox-sensing capabilities:

  • Pre-protein translocation into chloroplasts is accomplished by two distinct machineries in the outer (Toc) and inner (Tic) envelope membranes.

  • TIC55 belongs to the class of Rieske-type iron-sulfur proteins, which can be modified by diethylpyrocarbonate (DEPC).

  • Import experiments demonstrated that DEPC treatment inhibited protein import specifically at the inner envelope membrane, suggesting TIC55's involvement in this process .

  • The Rieske center and mononuclear iron-binding site likely function as a redox sensor during pre-protein translocation in chloroplasts .

What other proteins does TIC55 interact with in the chloroplast import machinery?

TIC55 has been shown to interact with several other components of the chloroplast protein import machinery through co-purification and immunoprecipitation studies:

Interacting ProteinFunctionMethod of DetectionReference
TIC110Core component of transloconBN-PAGE, co-immunoprecipitation
ClpCChaperone involved in protein importBN-PAGE
TIC6260 kDa protein, NAD(P)-binding componentCo-immunoprecipitation
TIC40Co-chaperone, facilitates translocationCo-immunoprecipitation
TIC32Calmodulin-binding translocon componentAssociation in membrane complexes

Research methodology: Protein complexes were isolated from chloroplast inner envelope membranes using blue native gel electrophoresis (BN-PAGE), followed by second-dimension SDS-PAGE to separate individual components. The identities of interacting proteins were confirmed by immunoblotting with specific antibodies and by co-immunoprecipitation experiments .

What are the most effective methods for expressing and purifying recombinant TIC55 protein?

Recombinant TIC55 protein can be successfully expressed and purified using the following optimized protocol:

  • Expression System Selection:

    • Most successful expressions utilize E. coli BL21(DE3) cells

    • The pET21d vector with a C-terminal polyhistidine tag has proven effective for expression and subsequent purification

  • Expression Conditions:

    • Induce with 0.5-1.0 mM IPTG at OD600 of 0.6-0.8

    • Grow at reduced temperature (18-20°C) post-induction to enhance proper folding of iron-sulfur clusters

    • Expression for 16-18 hours yields optimal protein levels

  • Purification Strategy:

    • Lyse cells in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 5% glycerol, and protease inhibitors

    • Purify using Ni-NTA agarose affinity chromatography

    • Remove imidazole by dialysis against 100 mM NaCl, 10 mM Tricine pH 7.6

    • For functional studies, supplement buffers with iron and sulfur sources during purification

The yield is typically 2-5 mg of purified protein per liter of bacterial culture. For functional studies, reconstitution of the iron-sulfur cluster may be necessary after purification.

How can researchers effectively generate and characterize TIC55 knockout mutants?

Generation and characterization of TIC55 knockout mutants involves multiple steps to ensure complete gene disruption and phenotype verification:

  • Mutant Selection/Generation:

    • In Arabidopsis, T-DNA insertion lines are available through repositories like ABRC (e.g., SALK_086048 line)

    • For Pisum sativum, CRISPR-Cas9 targeting of the first exon has proven effective

    • Alternative approaches include RNAi-mediated knockdown for partial silencing

  • Confirmation of Knockout:

    • Genomic PCR to confirm T-DNA insertion site (primers flanking the insertion and T-DNA border primers)

    • RT-PCR to verify absence of full-length transcript (1.6 kb transcript in wild-type should be absent in mutant)

    • Protein gel blot analysis with TIC55-specific antibody (αTIC55) to confirm complete absence of TIC55 protein in total protein extracts and isolated chloroplasts

  • Phenotypic Characterization:

    • Under standard growth conditions, no significant morphological differences may be observed between TIC55 knockout mutants and wild-type plants

    • Specific phenotypes emerge under dark-induced senescence conditions (see Section 3.1)

This methodological approach ensures true knockout mutants for subsequent functional analyses.

What techniques are most appropriate for studying TIC55's role in protein-protein interactions within the chloroplast?

Several complementary techniques have proven effective for investigating TIC55's protein-protein interactions:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):

    • Isolate inner envelope membranes from chloroplasts

    • Solubilize with mild detergents (1% digitonin or 1.5% decyl maltoside)

    • Separate native protein complexes on 5-12% gradient gels

    • Perform second-dimension SDS-PAGE to identify individual components

    • This approach successfully identified TIC55 as part of a complex with TIC110 and ClpC

  • Co-immunoprecipitation (Co-IP):

    • Solubilize chloroplast membranes in HKG buffer (25 mM HEPES-KOH, pH 8.0, 50 mM KCl, 10% glycerol)

    • Incubate with anti-TIC55 antibody followed by Protein A

    • Analyze precipitated proteins by immunoblotting

    • This technique confirmed interactions with TIC62, TIC110, and TIC40

  • Sucrose Density Gradient Centrifugation:

    • Fractionate solubilized membrane complexes on 5-20% sucrose gradients

    • Collect fractions and analyze by immunoblotting

    • This approach showed co-migration of TIC55 with other Tic complex components

  • Chemical Cross-linking:

    • Treat isolated chloroplasts with membrane-permeable cross-linkers

    • Analyze cross-linked products by immunoblotting

    • Identify interaction partners by mass spectrometry

The combination of these techniques provides robust evidence for genuine protein-protein interactions involving TIC55.

How does TIC55 contribute to the regulation of dark-induced leaf senescence?

TIC55 plays a significant role in dark-induced leaf senescence through multiple mechanisms:

  • Chlorophyll Catabolism:

    • TIC55 functions as a hydroxylase of phyllobilins, which are products of chlorophyll breakdown during senescence

    • In tic55-II knockout mutants of Arabidopsis, individually darkened leaves (IDLs) contain significantly higher chlorophyll concentrations than wild-type plants, indicating delayed chlorophyll breakdown

  • Regulation of Senescence-Associated Genes (SAGs):

    • Microarray analysis and qRT-PCR validation revealed that seven key senescence-associated genes are downregulated in tic55-II knockout mutants under dark-induced conditions:

    GeneFunctionFold Change (tic55-II/WT)
    SAG12Cysteine protease-7.388
    DIN2/DIN11β-glucosidase/2-oxoacid-dependent dioxygenase-3.735
    SAG13Senescence-associated protein-3.353
    APG7Ubiquitin-like modifier-activating enzyme-2.533
    YLS9Late embryogenesis abundant hydroxyproline-rich glycoprotein-2.520
    ASP3Aspartate aminotransferase-2.107

    This indicates that TIC55 functions indirectly in regulating downstream SAG expression .

  • Involvement in Transcription Factor Networks:

    • Four NAC genes (ANAC003, ANAC010, ANAC042, and ANAC075) are downregulated in tic55-II knockout mutants

    • Yeast one-hybrid assays demonstrated that the ANAC003 promoter can be bound by MYB108, suggesting TIC55's involvement in a MYB-NAC regulatory network that controls dark-induced senescence

These findings collectively indicate that TIC55 functions as a key component in the signaling pathway that leads to dark-induced leaf senescence in Arabidopsis thaliana.

How do researchers distinguish between TIC55's roles in protein import versus plant senescence?

Distinguishing between TIC55's dual functions requires specific experimental approaches:

  • Protein Import Assays:

    • In vitro import assays using isolated chloroplasts from wild-type and tic55 knockout plants

    • Measurement of 35S-labeled precursor protein import efficiency

    • In pea, DEPC treatment (which modifies the Rieske iron-sulfur cluster) inhibits protein import, suggesting TIC55's involvement

    • In Arabidopsis, tic55-II knockout mutants show no significant defects in protein import, indicating species-specific differences

  • Senescence Phenotyping:

    • Dark-induced senescence assays on individually darkened leaves (IDLs)

    • Measurement of chlorophyll retention in wild-type versus tic55 knockout plants

    • Analyses show that tic55-II knockout mutants retain significantly more chlorophyll under dark-induced senescence conditions

  • Gene Expression Analysis:

    • Microarray and qRT-PCR analyses of senescence-associated genes

    • Studies demonstrate downregulation of multiple SAGs in tic55-II knockout mutants under dark-induced conditions

    • Expression patterns of protein import-related genes show no significant differences

  • Complementation Studies:

    • Expression of wild-type TIC55 in knockout backgrounds restores the normal senescence phenotype

    • Site-directed mutagenesis of the Rieske center or mononuclear iron-binding site can determine which domains are essential for each function

These approaches collectively indicate that while TIC55 may participate in protein import in some species (like pea), its role in plant senescence appears to be conserved and functionally significant across multiple plant species.

What stress conditions modulate TIC55 expression and function?

Research has identified specific stress conditions that affect TIC55 expression and function:

  • Dark-Induced Stress:

    • Dark treatment significantly impacts TIC55 function, as evidenced by the delayed senescence phenotype in tic55-II knockout mutants

    • Individually darkened leaves (IDLs) show differential expression of senescence-related genes in tic55-II knockout mutants compared to wild-type plants

  • Other Abiotic Stresses:

    • Cold, heat, and high osmotic pressure treatments do not cause visible effects on tic55-II mutant plants when compared to wild-type Arabidopsis

    • This suggests TIC55's function is specifically related to dark-induced stress rather than general abiotic stress responses

  • Expression Patterns:

    • Tissue-specific expression analysis using publicly available Affymetrix GeneChip microarray data (accessed via Genevestigator) revealed that:

      • TIC55 expression is highest in photosynthetic tissues

      • Expression is augmented in cotyledons, sepals, cauline leaves, and senescent leaves

      • TIC55 expression increases in response to leaf aging

These findings indicate that TIC55 functions primarily in response to dark-induced stress and natural senescence rather than other abiotic stresses, suggesting a specialized role in chlorophyll breakdown and leaf senescence pathways.

How does TIC55 function differ between Pisum sativum and Arabidopsis thaliana?

Comparative studies between Pisum sativum (pea) and Arabidopsis thaliana have revealed important functional differences in TIC55:

  • Protein Import Function:

    • In Pisum sativum, TIC55 contains a redox-related motif that appears essential for protein import into chloroplasts

    • Diethylpyrocarbonate (DEPC) treatment, which modifies the Rieske iron-sulfur cluster, inhibits protein import in pea chloroplasts

    • In Arabidopsis thaliana, TIC55 is not crucial for protein import, as tic55-II knockout mutants show no significant protein import defects

  • Structural Conservation:

    • The primary structure of TIC55 from pea shows highest similarity to the Rieske center and mononuclear iron-binding site of LLS1 from maize

    • Both pea and Arabidopsis TIC55 contain conserved Rieske-type iron-sulfur clusters and mononuclear iron-binding sites, suggesting conservation of catalytic function despite divergence in physiological roles

  • Senescence Regulation:

    • In Arabidopsis, TIC55 clearly functions in dark-induced aging by regulating chlorophyll breakdown and senescence-associated gene expression

    • The role of TIC55 in senescence regulation in pea is less well-characterized, though its hydroxylase activity is likely conserved

These differences suggest evolutionary divergence in TIC55 function between plant species, with a shift from essential protein import roles in pea to specialized senescence regulation in Arabidopsis.

How can researchers effectively analyze TIC55 homologs across different plant species?

A comprehensive approach to analyzing TIC55 homologs across plant species includes:

  • Sequence Analysis and Phylogenetics:

    • Perform multiple sequence alignment of TIC55 sequences from diverse plant species

    • Focus on conservation of key domains (Rieske center, mononuclear iron-binding site, membrane-spanning regions)

    • Construct phylogenetic trees to establish evolutionary relationships

    • Key findings: The Rieske-type iron-sulfur cluster and mononuclear iron-binding sites are highly conserved across species, while other regions show greater variability

  • Structural Modeling:

    • Generate homology models based on known crystal structures of related Rieske-type proteins

    • Compare predicted tertiary structures to identify conserved structural elements

    • Analyze potential interaction surfaces and catalytic sites

  • Functional Complementation Studies:

    • Express TIC55 homologs from different species in Arabidopsis tic55-II knockout background

    • Assess restoration of wild-type phenotypes under dark-induced senescence conditions

    • Quantify chlorophyll retention and senescence-associated gene expression

  • Comparative Expression Analysis:

    • Analyze expression patterns of TIC55 homologs across tissues and developmental stages

    • Compare responses to dark treatment and senescence induction

    • Identify co-expressed genes to determine conservation of regulatory networks

This integrated approach enables researchers to determine both structural conservation and functional divergence of TIC55 across the plant kingdom, providing insights into the evolution of chloroplast protein import and senescence regulation.

How might TIC55's hydroxylase activity be exploited for biotechnological applications?

TIC55's hydroxylase activity offers several potential biotechnological applications:

  • Chlorophyll Degradation Control:

    • Modulation of TIC55 expression or activity could extend the shelf life of harvested leafy vegetables by delaying chlorophyll breakdown

    • Engineering TIC55 variants with enhanced or reduced activity could control the rate of senescence in agricultural crops

    • This could potentially reduce post-harvest losses and maintain nutritional quality for longer periods

  • Phyllobilin Modification:

    • TIC55's ability to hydroxylate phyllobilins (chlorophyll breakdown products) could be harnessed for producing modified tetrapyrroles with novel properties

    • These modified tetrapyrroles might have applications as photosensitizers in photodynamic therapy or as fluorescent probes in biological imaging

  • Metabolic Engineering:

    • The Rieske-type iron-sulfur cluster and mononuclear iron-binding site in TIC55 could be exploited for engineering novel oxygenase activities

    • This could enable production of hydroxylated compounds of pharmaceutical or industrial importance

  • Stress Response Modulation:

    • Given TIC55's role in dark-induced senescence, manipulating its expression or activity could enhance crop resilience to specific environmental stresses

    • This might be particularly relevant for improving crop performance under conditions that trigger premature senescence

These applications require detailed understanding of TIC55's structure-function relationships and the development of methods to modulate its activity in a controlled manner.

What experimental approaches can resolve contradictory findings about TIC55 function across different studies?

To resolve contradictions in TIC55 research findings, several targeted experimental approaches are recommended:

  • Standardized Experimental Conditions:

    • Develop standardized protocols for plant growth, chloroplast isolation, and protein import assays

    • Control for plant age, light conditions, and physiological status

    • Document all experimental variables thoroughly to enable direct comparisons between studies

  • Multiple Genetic Approaches:

    • Generate and characterize multiple independent knockout/knockdown lines

    • Create complementation lines expressing the wild-type gene under native and constitutive promoters

    • Develop inducible expression systems to control timing of TIC55 expression

  • Domain-Specific Mutations:

    • Introduce point mutations in specific functional domains:

      • Rieske iron-sulfur center (e.g., mutations in conserved histidine residues)

      • Mononuclear iron-binding site

      • Membrane-spanning regions

    • Assess the impact of these mutations on both protein import and senescence phenotypes

  • Comparative Analysis Across Species:

    • Perform functional studies in multiple plant species under identical conditions

    • Investigate species-specific differences in TIC55 expression, localization, and protein interactions

    • Express TIC55 from different species in Arabidopsis tic55-II background to test functional conservation

  • Integration of Multiple Techniques:

    • Combine in vivo phenotypic analyses with in vitro biochemical assays

    • Correlate protein-protein interaction data with functional outcomes

    • Use advanced imaging techniques to visualize TIC55 localization and dynamics

These approaches can help resolve apparent contradictions by identifying species-specific differences, context-dependent functions, and potential technical artifacts in previous studies.

What are the most promising directions for future research on TIC55's role in chloroplast function and plant development?

Future research on TIC55 should focus on several promising directions:

These research directions will provide a more comprehensive understanding of TIC55's multifaceted roles in plant biology and potentially lead to practical applications in agriculture and biotechnology.

What are the main technical challenges in studying TIC55 and how can researchers overcome them?

Researchers face several technical challenges when studying TIC55, along with potential solutions:

  • Protein Stability and Solubility Issues:

    • Challenge: TIC55 contains membrane-spanning domains and iron-sulfur clusters that can affect stability and solubility

    • Solutions:

      • Use mild detergents (0.5-1% digitonin or decyl maltoside) for membrane protein extraction

      • Express truncated versions lacking membrane domains for structural studies

      • Include iron and sulfur sources during recombinant expression and purification

      • Optimize buffer conditions to maintain iron-sulfur cluster integrity

  • Functional Assay Development:

    • Challenge: Developing reliable assays for TIC55's hydroxylase activity

    • Solutions:

      • Synthesize or isolate phyllobilin substrates from senescent leaves

      • Develop HPLC or LC-MS methods to detect hydroxylated products

      • Create coupled enzyme assays that link hydroxylation to a detectable signal

      • Use oxygen consumption measurements as an indirect measure of enzymatic activity

  • Species-Specific Differences:

    • Challenge: Reconciling contradictory findings between pea and Arabidopsis

    • Solutions:

      • Design comparative studies using identical methodologies across species

      • Create chimeric proteins combining domains from different species to identify functional differences

      • Develop heterologous expression systems to study TIC55 from multiple species

  • Pleiotropic Effects in Genetic Studies:

    • Challenge: Distinguishing direct versus indirect effects of TIC55 manipulation

    • Solutions:

      • Generate inducible knockdown/knockout systems to control timing of TIC55 depletion

      • Use tissue-specific promoters to restrict genetic manipulation to specific cell types

      • Perform time-course studies to distinguish primary from secondary effects

These methodological improvements can significantly enhance the quality and reliability of TIC55 research outcomes.

How should researchers interpret contradictory data on TIC55's role in protein import versus senescence regulation?

When faced with seemingly contradictory data regarding TIC55's roles, researchers should consider the following interpretive framework:

By considering these factors, researchers can develop more nuanced interpretations of seemingly contradictory data and design experiments to directly test competing hypotheses.

What CRISPR-Cas9 strategies are most effective for generating TIC55 knockout or modified plants?

Effective CRISPR-Cas9 strategies for TIC55 manipulation include:

  • Target Site Selection:

    • Design gRNAs targeting the first exon of TIC55 to ensure early disruption of the coding sequence

    • Target conserved domains (Rieske center or iron-binding site) for specific functional disruption

    • Multiple recommended target sites:

      • Positions 140-160 (Rieske domain)

      • Positions 245-265 (mononuclear iron-binding site)

      • First exon for complete knockout

  • Vector Design Considerations:

    • Use plant-optimized Cas9 (e.g., plant codon-optimized SpCas9)

    • Express gRNAs from U6 or U3 promoters for high expression

    • Include appropriate selection markers (e.g., Basta resistance, hygromycin resistance)

    • Consider tissue-specific or inducible promoters for controlled TIC55 disruption

  • Delivery Methods:

    • For Arabidopsis: Agrobacterium-mediated floral dip transformation

    • For pea and other recalcitrant species: Particle bombardment of embryonic tissues or Agrobacterium-mediated transformation of explants followed by regeneration

  • Screening and Validation:

    • PCR-based genotyping using primers flanking the target site

    • T7 Endonuclease I assay for detecting mutations

    • Sanger sequencing to confirm exact mutation type

    • RT-PCR and Western blotting to confirm absence of functional transcript and protein

  • Advanced Editing Strategies:

    • Base editing for introducing specific amino acid changes without double-strand breaks

    • Prime editing for precise modifications to study structure-function relationships

    • Multiplex editing to target multiple sites simultaneously or create larger deletions

These CRISPR strategies enable precise manipulation of TIC55 for detailed functional studies across different plant species.

How can researchers effectively generate TIC55 overexpression lines for functional studies?

To generate effective TIC55 overexpression lines, researchers should consider:

  • Promoter Selection:

    • Constitutive promoters (35S CaMV, Ubiquitin) for high expression throughout the plant

    • Tissue-specific promoters (RbcS, CAB) for targeted expression in photosynthetic tissues

    • Inducible promoters (estrogen-, dexamethasone-, or ethanol-inducible) for temporal control

  • Construct Design:

    • Include the complete TIC55 coding sequence with optimized Kozak sequence

    • Add C-terminal tags (His, HA, or GFP) for detection and purification

    • Ensure the transit peptide is included for proper chloroplast targeting

    • Consider including introns to enhance expression

  • Transformation Methods:

    • Agrobacterium-mediated transformation for Arabidopsis and most dicots

    • Particle bombardment for monocots or recalcitrant species

    • Protoplast transformation for transient expression studies

  • Selection and Validation:

    • RT-qPCR to quantify TIC55 transcript levels (expect 5-20 fold increase)

    • Western blotting to confirm protein overexpression

    • Immunolocalization to verify chloroplast targeting

    • Functional assays to confirm biological activity (e.g., accelerated senescence phenotype)

  • Experimental Controls:

    • Include lines expressing catalytically inactive TIC55 (mutations in iron-sulfur cluster)

    • Create lines with altered subcellular targeting to distinguish compartment-specific functions

    • Generate vector-only transformants as negative controls

This comprehensive approach ensures the generation of well-characterized TIC55 overexpression lines suitable for detailed functional analyses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.