Recombinant Pisum sativum Translocon at the outer membrane of chloroplasts 64 (TOC64)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pisum sativum TOC64

Recombinant Pisum sativum Translocon at the Outer Membrane of Chloroplasts 64 (TOC64) refers to a 64 kDa subunit of the preprotein translocon located in the outer envelope of chloroplasts, specifically in Pisum sativum (garden pea) . TOC64 is involved in the import of proteins into chloroplasts . It is a component of the TOC complex, which mediates the recognition and translocation of different precursor proteins . TOC64 interacts with cytosolic chaperones and is crucial for the targeting of proteins to the chloroplasts .

Identification and Purification

TOC64 was identified through fractionation of digitonin-solubilized outer envelope membranes on a sucrose density gradient . It co-fractionates with other established TOC subunits, such as Toc34, Toc75, and the 86-kD fragment of Toc160 . TOC64 can be purified from outer envelope membrane vesicles using SDS-PAGE, and an antiserum can be raised against the heterologously expressed protein for further study .

Functional Analysis

TOC64 functions as a bi-functional preprotein receptor . The cytosolic TPR domain serves as a docking site for Hsp90-bound precursor proteins . The intermembrane space-exposed domain facilitates the association of TOC64 with the TOC complex and participates in precursor protein recognition and translocation across the intermembrane space .

In vitro translocation assays show that adding TOC64 or Toc34ΔTMGTP from Pisum sativum significantly reduces the import of the precursor of the small subunit of RubisCO (pSSU) into isolated organelles . This suggests that TOC64 and Toc34 act as receptors for preproteins .

Interactions with Other Proteins

TOC64 interacts with other components of the TOC complex, including Toc34 and Toc159 . The cytosolic regions of these receptors mediate their interaction . TOC64 also interacts with Hsp90, a molecular chaperone that delivers precursor proteins to the chloroplast .

TOC64 in Different Species

While TOC64 was initially identified and characterized in Pisum sativum, homologs exist in other plant species, including Arabidopsis thaliana . The Arabidopsis thaliana genome contains multiple genes encoding TOC64-like proteins, such as TOC64-III (AT3G17970) .

Research Findings

  • Receptor for Hsp90-bound preproteins TOC64 functions as a docking site for Hsp90-bound precursor proteins .

  • Role in preprotein translocation TOC64 is involved in precursor protein recognition and translocation across the intermembrane space .

  • Interaction with Toc complex TOC64 interacts with other components of the TOC complex, such as Toc34 and Toc159 .

  • TPR domain function The TPR domain of TOC64 is crucial for recognizing Hsp90 .

  • Amidases domain TOC64 exhibits homology to prokaryotic and eukaryotic amidases, though its enzymatic function is likely inactivated due to a point mutation .

Data Tables

Table 1: Presence of TOC and TIC Components in Different Genomes

ComponentChlamydomonas reinhardtiiAccession NumberE-value
Toc64PresentProtein IDVaries

Note: This table is a modified excerpt from a study analyzing the presence of TOC and TIC components across various genomes. For detailed information, refer to the original source .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TOC64; Translocon at the outer membrane of chloroplasts 64
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-593
Protein Length
full length protein
Species
Pisum sativum (Garden pea)
Target Names
TOC64
Target Protein Sequence
MKSMASPSSQIWVILGLGLAGIYVLTRKLTQAVKEDFGAFLLKLKLLPPPPPAPPKAPHP LSSLNFAISDIFDIEGHVSTFGHPEWARTHEPASSTASAVSALVESGATCIGTTVVDELA YGISGENKHFGTPTNPAVPNRVPGGSSSGAAVAVAANFVDFSLGVDTSGGVRVPAGFCGI LGFRPSHGAVSHVGIIPVSTSLDTVGWFAKDPDVLRRVGHILLQAPFVMQRNPRQIIIAD DCFQHLNVPLDRTSQVVIKATEKLFGKQVLKHINFEDYISSKVSSLKACSIQKSNGVLKS SSLKLLANVMQSLQRHEFEHTHSEWMSIVKPDLHPAVSAQLHEKFEVSELEIENSKSVRS ELRVAVNSLLKDEGVLVIPTVADPPPKLGGKEFLSHDYQSRALSLLSIASISGCCQVTVP LGFFDKNPVSVSLIARHGGDRFLLDTLKTMYTVLQEQADIAAPSKSSKSVVSKEQSAEIS KEKGNQAYKDKQWQKAIGFYTEAIKLCGNNATYYSNRAQAYLELGSYLQAEEDCTTAISF DKKNVKAYFRRGTAREMLGYYKEAIDDFKYALVLEPTNKRAASSAERLRKLFQ
Uniprot No.

Target Background

Function

Function: A chaperone receptor mediating Hsp90-dependent protein targeting to chloroplasts. It functions as a bi-functional preprotein receptor, acting on both sides of the chloroplast membrane.

Subcellular Location
Plastid, chloroplast outer membrane; Multi-pass membrane protein.

Q&A

What is TOC64 and what is its basic function in chloroplast protein import?

TOC64 (Translocon at the Outer membrane of Chloroplasts 64) is a 64 kDa protein component of the chloroplast protein import machinery located in the outer membrane of chloroplasts. It functions as part of the TOC complex that mediates the initial recognition and translocation of preproteins across the outer envelope membrane of chloroplasts. The TOC complex works in conjunction with the TIC (Translocon at the Inner Chloroplast membrane) complex to facilitate complete protein import into chloroplasts . TOC64 specifically contributes to the recognition and binding of preproteins, potentially serving as a docking site for cytosolic factors that deliver preproteins to the chloroplast surface.

How is recombinant Pisum sativum TOC64 typically produced for research purposes?

Recombinant Pisum sativum TOC64 is typically produced using E. coli expression systems. The full-length protein (amino acids 1-593) is expressed with an N-terminal His-tag to facilitate purification through affinity chromatography . After expression, the protein is purified and provided as a lyophilized powder. For research applications, it is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added as a stabilizing agent for long-term storage at -20°C/-80°C .

What is the relationship between TOC64 and other components of the chloroplast protein import machinery?

TOC64 functions as part of an integrated protein import system alongside other components of the TOC complex, which interfaces with the TIC complex to facilitate complete protein translocation across both chloroplast envelope membranes. While specific TOC64 interactions aren't detailed in the search results, we know that chloroplast protein import involves a coordinated process where:

  • Preproteins are recognized by the TOC complex components at the outer membrane

  • Translocation occurs through protein-conducting channels

  • The TIC complex (including components like Tic12, Tic20, Tic56, Tic100, and Tic214) mediates passage across the inner membrane

  • The import process is powered by an ATPase motor, with the Ycf2-FtsHi complex identified as the chloroplast import motor

How do temperature changes affect translocon component function and stability?

Temperature significantly impacts translocon components and their function. Research on the co-chaperone Tic40 reveals that temperature changes influence the levels and activity of translocon components. Specifically:

While this data pertains specifically to Tic40 rather than TOC64, it suggests that temperature regulation may be a general feature of chloroplast translocon components, potentially including TOC64. This temperature responsiveness likely represents an adaptation to changes in the pre-protein population and accompanying demands placed on the plastid translocon under different environmental conditions .

What techniques are used to study protein-protein interactions within the translocon complex?

Several sophisticated techniques are employed to study interactions between translocon components and with translocating preproteins:

  • Site-specific UV crosslinking: Used to identify direct interactions between translocon components and transiting preproteins, as demonstrated with Tic12 and Tic20 interacting with transit peptides

  • Structural biology approaches: Cryo-electron microscopy has revealed structures of the Ycf2-FtsHi and TIC complexes from Arabidopsis and an ultracomplex formed between them from Pisum, providing insights into how these components assemble and cooperate during preprotein translocation

  • In vitro import experiments: Used to assess component involvement in preprotein translocation by examining translocation intermediates. These experiments typically use various model preproteins, such as HA-tagged ferredoxin preprotein (pFd-HA), FLAG-tagged preprotein for light-harvesting chlorophyll-binding protein (pLHCP-3xFLAG-ProteinA), and FLAG-tagged preprotein for chloroplast-localized ribosomal protein L11 (pL11-3xFLAG-ProteinA)

What factors influence the assembly and disassembly of translocon complexes?

The assembly and disassembly of translocon complexes are influenced by multiple factors:

  • Ionic strength: High-salt conditions combined with detergents like Triton X-100 can disassociate components like Tic12 from the TIC complex, suggesting that electrostatic interactions play a role in complex stability

  • Structural adaptors: The Ycf2-FtsHi complex includes previously uncharacterized components that aid in complex assembly and anchor the motor module at a tilted angle relative to the membrane

  • Temperature: As noted with Tic40, temperature can influence the formation of protein complexes involving translocon components, potentially affecting assembly dynamics

  • Protein-protein interactions: Specific interactions between translocon components are crucial for proper assembly and function. The identification of new essential components like Tic12 demonstrates the complexity of these interactions and their importance for translocon function

How should recombinant TOC64 be handled and reconstituted for experimental use?

For optimal handling and reconstitution of recombinant TOC64, follow these methodological guidelines:

  • Initial handling: Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitution protocol:

    • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is the default recommendation)

    • Aliquot for long-term storage at -20°C/-80°C

  • Storage considerations:

    • Avoid repeated freeze-thaw cycles as these can damage protein structure and function

    • For working solutions, store aliquots at 4°C for up to one week

    • For long-term storage, use -20°C/-80°C with proper cryoprotectants

What approaches are used to study translocon-mediated protein import in chloroplasts?

Researchers employ several methodological approaches to study chloroplast protein import:

  • In vitro import assays: These assays use isolated intact chloroplasts to study the import of various preproteins. Typical model preproteins include:

    • HA-tagged ferredoxin preprotein (pFd-HA)

    • FLAG-tagged preprotein for light-harvesting chlorophyll-binding protein (pLHCP)

    • FLAG-tagged preprotein for chloroplast-localized ribosomal protein L11 (pL11)

  • Translocation intermediate analysis: By trapping preproteins during translocation, researchers can identify which translocon components interact with the preprotein at different stages of import

  • Genetic approaches: Studies using null mutants (like tic12 null mutants) help establish the essentiality of translocon components. These mutants often display albino and seedling-lethal phenotypes, similar to other tic null mutants

  • Protein processing analysis: In vitro systems can be used to study the processing of precursor proteins, as demonstrated with seed storage proteins in Pisum sativum, providing insights into how proteins are modified during or after import

How can researchers assess the functional activity of recombinant translocon components?

Assessing the functional activity of recombinant translocon components involves several experimental approaches:

  • Reconstitution in liposomes: Recombinant components can be incorporated into artificial membrane systems to assess their ability to form channels or facilitate protein translocation

  • Binding assays: Measuring the binding affinity of recombinant components to preproteins or other translocon components can provide insights into their functional capacity

  • Complementation studies: Introducing recombinant components into systems where the endogenous component has been deleted or inactivated can demonstrate functional equivalence

  • Temperature-dependent activity assays: Given the temperature-responsiveness of translocon components like Tic40, assessing activity across a temperature range can reveal functional properties of recombinant proteins

How might understanding TOC64 and the translocon complex contribute to plant biotechnology?

Understanding TOC64 and the broader translocon complex has significant implications for plant biotechnology:

  • Improved protein targeting: Enhanced knowledge of protein import machinery could facilitate more efficient targeting of recombinant proteins to chloroplasts for biotechnological applications

  • Stress tolerance engineering: The temperature responsiveness of translocon components suggests potential targets for improving plant stress tolerance through modification of protein import efficiency under adverse conditions

  • Crop improvement: Given the essential nature of protein import for chloroplast function, optimizing this process could lead to improved photosynthetic efficiency and crop productivity

  • Novel herbicide targets: The essentiality of translocon components for plant survival (evidenced by lethal phenotypes of null mutants) suggests potential targets for herbicide development

What are the key unresolved questions regarding TOC64 function and the chloroplast protein import machinery?

Several critical questions remain unanswered regarding TOC64 and chloroplast protein import:

  • Detailed mechanisms of preprotein recognition: While we know components like TOC64 are involved in preprotein recognition, the precise molecular mechanisms remain incompletely understood

  • Regulatory networks: How environmental factors and developmental signals modulate the activity and composition of the translocon complex requires further investigation

  • Evolutionary considerations: The evolutionary relationships between translocon components across different plant species and how these relate to functional specialization remain to be fully elucidated

  • Integration with other cellular processes: How chloroplast protein import coordinates with other cellular processes, including protein synthesis, folding, and degradation, represents an important area for future research

What factors might affect the stability and functionality of recombinant TOC64 in experimental settings?

Several factors can impact the stability and functionality of recombinant TOC64:

  • Buffer conditions: Ionic strength and pH can significantly affect protein stability and functionality; optimal conditions should be determined empirically

  • Temperature considerations: As observed with other translocon components like Tic40, temperature can affect complex formation and stability

  • Membrane environment: As a membrane protein, TOC64 may require a suitable lipid environment to maintain its native conformation and function

  • Storage stability: Proper storage with cryoprotectants like glycerol is essential to maintain protein functionality during freeze-thaw cycles

  • Protein concentration: Appropriate protein concentration is crucial for maintaining solubility while enabling functional studies

How can researchers verify the integrity and proper folding of recombinant TOC64?

To verify the integrity and proper folding of recombinant TOC64, researchers should consider:

  • SDS-PAGE analysis: To confirm protein purity and molecular weight (expected to be greater than 90% as determined by SDS-PAGE)

  • Circular dichroism (CD) spectroscopy: To assess secondary structure composition and proper folding

  • Functional assays: Testing the ability of recombinant TOC64 to interact with known binding partners or participate in in vitro import assays

  • Limited proteolysis: Properly folded proteins typically show characteristic proteolytic patterns different from misfolded variants

  • Size exclusion chromatography: To detect aggregation or oligomerization that might affect functionality

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.