Recombinant Plasmodium falciparum ER lumen protein retaining receptor (ERD2)

Shipped with Ice Packs
In Stock

Description

Biological Function and Localization

  • Role in Protein Trafficking:
    PfERD2 is concentrated in the cis-Golgi and mediates retrograde transport of ER-resident proteins. Brefeldin A (BFA) treatment redistributes PfERD2 to the ER, confirming its dynamic role in vesicular trafficking .

  • Colocalization Studies:

    • Colocalizes with Golgi markers (e.g., Rab6) and rhoptry-associated proteins, though not directly associated with rhoptry organelles .

    • Pearson’s correlation coefficients:

      • PfERD2 vs. Golgi markers: 0.83

      • PfERD2 vs. rhoptry markers: 0.51

A. Functional Complementation:

PfERD2 restores ER protein retention in yeast erd2 mutants, demonstrating functional conservation across eukaryotes .

B. Drug Interaction Studies:

  • BFA disrupts PfERD2 localization, validating its role in Golgi-ER trafficking .

  • PfERD2’s structural stability in E. coli makes it suitable for inhibitor screening .

C. Immunolocalization:

Indirect immunofluorescence reveals PfERD2 as a perinuclear focus in trophozoites and schizonts, consistent with Golgi localization .

Comparative Analysis Across Species

SpeciesERD2 Identity vs. PfERD2Functional Complementarity in Yeast
Saccharomyces cerevisiae42%Yes
Homo sapiens38%No
Toxoplasma gondii51%Yes

Implications for Malaria Research

  • Therapeutic Targets: PfERD2’s role in secretory pathways highlights its potential as a drug target to disrupt parasite protein trafficking .

  • Diagnostic Challenges: While unrelated to ERD2, pfhrp2/3 deletions in P. falciparum (linked to false-negative RDTs) underscore the need for multi-antigen diagnostics .

References (Integrated Citations)

  • Recombinant ERD2 production and specifications .

  • Functional studies in yeast and BFA effects .

  • Colocalization and trafficking mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ERD2; PF13_0280; ER lumen protein-retaining receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Plasmodium falciparum (isolate 3D7)
Target Names
ERD2
Target Protein Sequence
MNIFRLIGDILHLVSMYILIMKLKKSKNCIGISCRMQELYLIVFLCRYIDLFFVFVSFYN TVMKITFILTIAYTIYLIRLKLPISQTYNRKVDNFKSEKYLIPPCLVLSLLTCKTYNLYN ILWSFSIWLESVAILPQLVLLEKQREVENITSHYVITMGLYRAFYILNWIYRYFFDDKPY INVVGWIGGLIQTLLYIDFFYYFALAKWYGKKLVLPFNGEV
Uniprot No.

Target Background

Function
Essential for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular trafficking through the Golgi apparatus.
Database Links
Protein Families
ERD2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is PfERD2 and how does it compare to homologues in other organisms?

PfERD2 functions as the Plasmodium falciparum homologue of the endoplasmic reticulum (ER) retention receptor found in mammals and yeast. This receptor recognizes and binds proteins containing K(H)DEL C-terminal motifs, facilitating their retrieval from the Golgi apparatus back to the ER. Molecular characterization reveals that PfERD2 shares 42% sequence identity with its mammalian and yeast counterparts, with particularly striking conservation in its predicted tertiary structure .

To understand PfERD2's evolutionary relationship with other ERD2 proteins, researchers should perform multiple sequence alignments using tools like MUSCLE or CLUSTALW, followed by phylogenetic analysis using maximum likelihood or Bayesian methods. These comparative approaches reveal conservation of key functional regions across species while highlighting parasite-specific adaptations that could be targeted for therapeutic intervention.

What is the subcellular localization pattern of PfERD2?

PfERD2 exhibits a highly specific subcellular distribution, being tightly confined to a single focus of staining in the perinuclear region as observed through indirect immunofluorescence techniques . This focused localization pattern is consistent with the protein's concentration in the Golgi apparatus, similar to its homologues in other eukaryotes.

When investigating PfERD2 localization, researchers should employ co-localization studies with established organelle markers. Confocal microscopy using antibodies against PfERD2 and markers for the Golgi apparatus, ER, and other compartments allows precise determination of the protein's distribution. Super-resolution microscopy techniques like STORM or PALM can further refine understanding of its exact localization within the secretory pathway components.

How does Brefeldin A affect PfERD2 distribution and what does this tell us about its trafficking?

Treatment with Brefeldin A (BFA) causes a dramatic redistribution of PfERD2 from its concentrated perinuclear focus to a diffuse pattern that resembles the distribution of BiP, an established ER marker protein . Importantly, this effect is reversible - removal of BFA results in the recovery of the focused localization pattern.

This BFA-induced redistribution provides strong evidence that PfERD2 normally localizes to the parasite Golgi apparatus and participates in retrograde transport pathways back to the ER. For experimental protocols, researchers should optimize BFA concentrations (typically 5-10 μg/ml) and treatment times (30 minutes to 2 hours) for P. falciparum, followed by immunofluorescence analysis using anti-PfERD2 antibodies. Time-course experiments during BFA recovery can reveal the kinetics of retrograde and anterograde transport machinery in the parasite.

What is the proposed mechanism for PfERD2-mediated protein retention?

The primary function of PfERD2 appears to mirror the established mechanism for its homologues in other eukaryotes. This process involves selective binding of proteins bearing C-terminal K(H)DEL motifs in the more acidic environment of the Golgi (pH ~6.2-6.7), followed by retrograde transport of these complexes to the ER via COPI-coated vesicles . Upon reaching the neutral pH of the ER (approximately pH 7.2), ligands dissociate from the receptor, allowing their retention in the ER lumen while PfERD2 returns to the Golgi for additional rounds of retrieval.

To study this pH-dependent binding experimentally, researchers should develop in vitro binding assays using purified recombinant PfERD2 and model K(H)DEL-containing ligands under different pH conditions. Surface plasmon resonance or microscale thermophoresis can quantitatively measure binding affinities and kinetics, while site-directed mutagenesis of putative pH-sensing residues can identify key functional elements of the receptor.

How does PfERD2 interact with the COPI vesicular transport machinery?

While direct experimental evidence for PfERD2 interactions with COPI machinery in P. falciparum remains limited, models based on other eukaryotic systems suggest that ligand binding induces conformational changes in PfERD2 that expose binding sites for COPI components . These interactions likely involve binding to ARF1, ARF-GAP, and potentially p24 proteins for efficient sorting into COPI vesicles.

To investigate these interactions, researchers should employ co-immunoprecipitation studies with antibodies against PfERD2 followed by mass spectrometry to identify interacting partners. Proximity labeling approaches such as BioID or APEX2 fused to PfERD2 can reveal the protein's interactome in living parasites. Yeast two-hybrid or split-GFP complementation assays can validate specific interactions with predicted COPI components.

What structural features distinguish PfERD2 from other parasite membrane proteins?

PfERD2 likely shares the seven-transmembrane domain topology characteristic of ERD2 proteins, but with parasite-specific adaptations. The conserved nature of its tertiary structure with mammalian homologues suggests functional conservation despite primary sequence divergence .

Researchers investigating structural aspects should pursue recombinant expression and purification strategies optimized for membrane proteins, followed by structural determination via X-ray crystallography or cryo-electron microscopy. Computational approaches including homology modeling based on solved structures of mammalian KDELRs can predict binding pockets and functional domains. Circular dichroism spectroscopy can provide initial structural information about secondary structure content and stability under different conditions.

What expression systems are most effective for producing recombinant PfERD2?

Producing functional recombinant PfERD2 presents significant challenges due to its multi-transmembrane nature. While E. coli has been successfully used for expressing recombinant proteins from P. falciparum , membrane proteins often require eukaryotic expression systems that provide appropriate folding machinery and post-translational modifications.

For recombinant PfERD2 expression, researchers should consider:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coliHigh yield, simple cultivationLimited post-translational modifications, inclusion body formationUse membrane protein-optimized strains (C41/C43), fusion tags (MBP, SUMO), lower induction temperature (16-20°C)
Insect cellsBetter membrane protein folding, glycosylation capacityMore complex cultivation, moderate yieldsOptimize codon usage, use baculovirus expression vectors with strong promoters
Mammalian cellsNative-like folding and processingLower yields, expensiveUse inducible expression systems, stable cell lines
Cell-free systemsAvoids toxicity issues, direct membrane incorporationLimited scale, expensiveSupplement with detergents or lipid nanodiscs

Initial screening of multiple expression constructs with different affinity and solubility tags (His6, GST, MBP) is recommended to identify optimal conditions for obtaining functional protein.

What strategies can overcome difficulties in detecting PfERD2 in the ER?

Detection of PfERD2 in the ER compartment is challenging because, as described for plant ERD2, the receptor appears to have a very brief residence time in the ER and is restricted to a specific ER domain - likely the region immediately adjacent to the first cis-Golgi cisterna where COPI vesicles fuse and COPII vesicles exit .

To overcome these detection challenges, researchers should:

  • Employ super-resolution microscopy techniques (STED, STORM) that can resolve the small ER-Golgi interface regions.

  • Use rapid live-cell imaging with photoactivatable fluorescent protein fusions to capture transient ER localization.

  • Develop proximity labeling approaches where PfERD2 can tag nearby proteins even during brief interactions.

  • Consider artificially increasing PfERD2 concentration in the ER by overexpressing HDEL-containing ligands, which can shift the equilibrium of receptor distribution .

  • Use electron microscopy with immunogold labeling to precisely localize PfERD2 at the ultrastructural level.

How can recombinant PfERD2 fusion proteins be designed without compromising function?

Creating functional fluorescent fusion proteins with PfERD2 requires careful consideration of the receptor's topology and critical functional domains. Evidence from plant ERD2 studies indicates that both N- and C-terminal fluorescent protein fusions can potentially disrupt function .

When designing PfERD2 fusion constructs, researchers should:

  • Consider internal tagging strategies that insert fluorescent proteins into non-conserved loop regions identified through sequence alignments.

  • Test both N- and C-terminal fusions with flexible linker sequences (e.g., [Gly-Ser]n) of varying lengths.

  • Validate functionality of each construct using complementation assays in cells where endogenous ERD2 has been knocked down or knocked out.

  • Employ split fluorescent protein approaches where smaller tags might minimize functional disruption.

  • Design chimeric constructs with additional transmembrane domains as spacers, similar to the strategy employed for plant ERD2b .

How does PfERD2 function compare to PfERC in protein trafficking?

PfERC (P. falciparum ERC protein) and PfERD2 play distinct but complementary roles in the early secretory pathway. PfERC is a calcium-binding protein localized in the ER lumen with a C-terminal IDEL motif that facilitates its retention within the ER . In contrast, PfERD2 functions as the receptor that recognizes and retrieves such proteins bearing K(H)DEL-like motifs.

To differentiate between these proteins experimentally:

  • Perform co-localization studies using antibodies specific to each protein to visualize their distinct distributions.

  • Analyze their differential responses to treatments like brefeldin A (BFA), which causes PfERD2 to redistribute from Golgi to ER while PfERC maintains its ER localization.

  • Investigate their different binding partners through pull-down assays and co-immunoprecipitation studies.

  • Study their temporal expression patterns throughout the parasite life cycle using stage-specific transcriptomics and proteomics approaches.

What role might PfERD2 play in parasite stress responses?

ERD2 receptors generally contribute to cellular stress responses by maintaining proper ER function through retention of ER-resident chaperones and folding enzymes. During stress conditions that disrupt protein folding (such as antimalarial drug treatment), the demand for these chaperones increases.

To investigate PfERD2's role in stress responses, researchers should:

  • Monitor changes in PfERD2 expression and localization during various stress conditions (heat shock, oxidative stress, ER stress inducers like DTT or tunicamycin).

  • Perform conditional knockdown of PfERD2 to assess how reduced function affects parasite survival during stress.

  • Examine whether PfERD2 depletion alters the localization of key ER chaperones bearing KDEL-like motifs.

  • Investigate potential phosphorylation or other post-translational modifications of PfERD2 during stress conditions that might regulate its activity.

How might PfERD2 function as a potential drug target?

PfERD2's essential role in maintaining ER homeostasis makes it a potential target for novel antimalarial therapeutics. Its sequence and structural differences from human homologues (58% difference) could allow selective targeting.

Research approaches for exploring PfERD2 as a drug target include:

  • Developing high-throughput screening assays using recombinant PfERD2 to identify compounds that selectively inhibit its binding to KDEL-like motifs.

  • Structure-based drug design targeting parasite-specific regions of PfERD2 identified through homology modeling and molecular dynamics simulations.

  • Testing whether compounds that interfere with PfERD2 function cause mislocalization of essential ER proteins, disrupting parasite viability.

  • Assessing synergistic effects between PfERD2 inhibitors and current antimalarials that induce ER stress.

How can contradictory findings about PfERD2 localization be reconciled?

Contradictory findings regarding ERD2 localization are common across different experimental systems. For example, in plants, different studies have reported varying degrees of ER localization for fluorescently tagged ERD2 . These contradictions may result from technical limitations, differences in expression levels, or genuine biological variability.

To reconcile conflicting localization data:

  • Compare fixation methods - different fixation protocols can alter the apparent distribution of membrane proteins.

  • Evaluate expression levels - overexpression can saturate trafficking machinery and cause protein mislocalization.

  • Consider the impact of tags - as observed in plant studies, different fluorescent protein fusions can affect localization and function .

  • Examine cell type and developmental stage specificity - localization patterns may vary throughout the parasite life cycle.

  • Implement multiple complementary approaches - combine live imaging, immunofluorescence, and subcellular fractionation to build a consensus view.

What controls are essential when studying PfERD2 trafficking?

Robust experimental design for PfERD2 trafficking studies should include:

  • Positive controls: Well-characterized markers for Golgi (e.g., Rab proteins) and ER (e.g., BiP) compartments should be included to validate localization patterns.

  • Negative controls: Non-specific antibodies or untransfected cells should be examined to establish background signal levels.

  • Drug controls: Brefeldin A treatment serves as a positive control for redistribution from Golgi to ER .

  • Functional validation: Complementation assays demonstrating that tagged PfERD2 constructs can rescue loss of endogenous protein function.

  • Quantitative assessment: Image analysis should include quantification of co-localization coefficients rather than relying solely on visual inspection.

What methodological approaches can distinguish between direct and indirect effects on PfERD2 function?

When studying factors that affect PfERD2 function, distinguishing direct from indirect effects requires careful experimental design:

  • In vitro binding assays with purified components can establish direct physical interactions.

  • Rapid kinetic studies can determine whether effects occur too quickly to involve intermediate steps.

  • Dose-response relationships should be examined - direct effects often show different dose-response profiles than indirect ones.

  • Structure-activity relationship studies with compounds or mutations can identify specific interaction requirements.

  • Reconstitution experiments in simplified systems (liposomes, nanodiscs) can remove confounding cellular factors.

For genetic perturbations, conditional systems that allow rapid protein depletion or inactivation (such as auxin-inducible degrons or chemical-genetic approaches) can help separate immediate from adaptive effects on PfERD2 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.