Recombinant Plasmodium falciparum Sexual stage-specific protein

Shipped with Ice Packs
In Stock

Description

Introduction

The malaria parasite Plasmodium falciparum undergoes a complex life cycle involving both human and mosquito hosts. Sexual stage-specific proteins are crucial for the parasite's development and transmission from humans to mosquitoes . Among these proteins is a family of secreted proteins containing multiple adhesive domains, known as P. falciparum LCCL domain-containing proteins (PfCCp) . These proteins are expressed in the parasitophorous vacuole of differentiating gametocytes and later associate with macrogametes .

PfCCp Proteins

Five of the PfCCp proteins contain a Limulus coagulation factor C (LCCL) domain and are designated PfCCp1 through PfCCp5, while a sixth protein lacks this domain . Although most PfCCp proteins are involved in the parasite's development in the mosquito vector, their exact functions are still largely unknown .

Molecular Interactions

Research has shown that PfCCp proteins interact with each other during gametocyte development and emergence . Disrupting one PfCCp protein can lead to the loss of other family members . Co-immunoprecipitation assays have revealed that PfCCp proteins form multi-protein complexes, and affinity chromatography co-elution binding assays suggest direct binding between distinct adhesion domains . PfCCp-coated latex beads bind to newly formed macrogametes, but not to gametocytes or older macrogametes . These findings suggest that PfCCp proteins form multi-protein complexes during gametogenesis, mediating cell contacts of macrogametes .

Expression and Upregulation

Many P. falciparum proteins with signal peptides are upregulated and abundant at the sexual stage . Studies using RNA-Seq data have shown stage-specific gene expression patterns, with about half of these proteins being upregulated at the sexual stage . Candidate proteins are selected based on being upregulated by more than 5-fold at sexual stages and being abundantly expressed (more than 60 reads per gene) at these stages .

Role in Malaria Transmission

Malaria transmission depends on the interaction between the parasite and the mosquito midgut . Interactive proteins are considered ideal targets for blocking malaria transmission . Sexual stage proteins, like PfCCp, are critical for the parasite's ability to infect mosquitoes .

PfCCp and other Sexual Stage Proteins

PfCCp proteins may form a multimeric protein complex that includes other sexual stage antigens like Pfs230 and Pfs25 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Sexual stage-specific protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-157
Protein Length
Full Length of Mature Protein
Species
Plasmodium falciparum (isolate NF54)
Target Protein Sequence
DANDKAKKPAGKGSPSTLQTPGSSSGASLHAVGPNQGGLSQGLSGKDSADKMPLETQLAI EEIKSLSNMLDKKTTVNRNLIISTAVTNMIMLIILSGIVGFKVKKTKNADDDKGDKDKDK DNTDEGDEGDDS
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What are Plasmodium falciparum sexual stage-specific proteins and why are they important?

Plasmodium falciparum sexual stage-specific proteins are specialized proteins expressed during the sexual phase of the malaria parasite life cycle. This phase begins with the differentiation of predetermined blood stage parasites to gametocytes in the human host and continues with the formation of male and female gametes in the mosquito vector midgut . These proteins are critical for parasite development and transmission, making them important targets for intervention strategies aimed at blocking malaria transmission.

Among these proteins are the six secreted proteins with multiple adhesion domains, termed P. falciparum LCCL domain-containing protein (PfCCp) proteins, which are expressed in the parasitophorous vacuole of differentiating gametocytes and later associated with macrogametes . These proteins, along with others like Pfs25, Pfs28, Pfs230, and Pfs48/45, are considered promising candidates for components of transmission-blocking vaccines .

How are recombinant P. falciparum sexual stage-specific proteins typically produced?

Recombinant P. falciparum sexual stage-specific proteins are typically produced through heterologous expression systems, with Escherichia coli being the most commonly used expression host. The process generally involves:

  • PCR amplification of the target gene from P. falciparum genomic DNA or cDNA

  • Cloning into an appropriate expression vector (e.g., pET-28a)

  • Transformation into a compatible expression host (usually E. coli BL21 strain)

  • Induction of protein expression

  • Protein purification using affinity chromatography

For example, a typical recombinant P. falciparum sexual stage-specific protein may be fused to an N-terminal His-tag and expressed in E. coli, as seen in commercial preparations . Purification typically involves Ni-Nitriloacetic acid affinity chromatography (Ni-NTA) using HIS-select Nickel affinity gel, followed by anion exchange chromatography and gel permeation chromatography for higher purity .

What are the challenges in producing soluble and correctly folded recombinant P. falciparum proteins?

Several challenges exist in producing functional recombinant P. falciparum proteins:

  • Codon usage bias: P. falciparum has an AT-rich genome, creating a significant codon usage difference from E. coli, which can lead to translational stalling and truncated products.

  • Post-translational modifications: Many P. falciparum proteins require specific post-translational modifications that prokaryotic systems like E. coli cannot provide.

  • Protein complexity: Many sexual stage-specific proteins contain multiple domains and disulfide bonds that are difficult to form correctly in E. coli's reducing cytoplasm.

  • Protein solubility: P. falciparum proteins often form inclusion bodies when overexpressed in E. coli, requiring refolding procedures that may not yield properly folded proteins.

To address these challenges, researchers may employ strategies such as codon optimization, use of specialized E. coli strains designed for disulfide bond formation, expression as fusion proteins with solubility-enhancing tags, or alternative expression systems such as insect cells or mammalian cells for proteins requiring complex post-translational modifications .

What expression systems are best suited for different types of P. falciparum sexual stage proteins?

The optimal expression system depends on the specific properties of the target protein:

Expression SystemAdvantagesBest ForExamples
E. coliCost-effective, high yield, simple manipulationSmall, non-glycosylated proteins; domains without complex disulfide bondsSexual stage-specific protein (P17503) , PfJ23 domains
Yeast (P. pastoris, S. cerevisiae)Proper protein folding, some post-translational modificationsMedium-sized proteins requiring some glycosylationPfs25, some PfCCp domains
Insect cells (Baculovirus)Complex folding, post-translational modificationsMulti-domain proteins with disulfide bondsComplete PfCCp proteins, Pfs230, Pfs48/45
Mammalian cellsMost authentic post-translational modificationsHighly complex proteins requiring mammalian-specific modificationsFull-length complex sexual stage antigens
Cell-free systemsRapid production, avoids toxicity issuesToxic proteins, quick screeningVarious domains for binding studies

When expressing PfCCp proteins, which contain multiple adhesion domains and form multi-protein complexes , insect cell or mammalian expression systems are often preferred to ensure proper folding and formation of critical disulfide bonds essential for function.

What purification strategies yield the highest purity and activity for recombinant sexual stage proteins?

A multi-step purification approach typically yields the best results:

  • Initial capture: Affinity chromatography (typically Ni-NTA for His-tagged proteins) serves as the primary purification step. For sexual stage-specific proteins expressed with His-tags, HIS-select Nickel affinity gel is commonly used .

  • Intermediate purification: Ion exchange chromatography (IEX) to separate proteins based on charge differences. For many P. falciparum proteins, anion exchange chromatography on Hitrap TM Q-FF columns has proven effective .

  • Polishing: Size exclusion chromatography (gel filtration) on columns such as Superdex 200 to achieve high purity and remove aggregates .

  • Quality assessment: SDS-PAGE analysis to confirm purity (typically >90% is considered acceptable for most applications) .

For proteins intended for structural studies or vaccine development, additional purification steps may be necessary, including endotoxin removal using polymyxin B columns for E. coli-expressed proteins, particularly important for immunological studies involving sexual stage antigens like Pfs230 and Pfs48/45 .

How should recombinant P. falciparum sexual stage proteins be stored to maintain stability and activity?

Proper storage is critical for maintaining protein stability and functionality:

  • Short-term storage: For working aliquots, store at 4°C for up to one week .

  • Long-term storage: Store at -20°C or preferably -80°C, with the addition of 5-50% glycerol (final concentration) to prevent freeze-thaw damage .

  • Lyophilization: For extended stability, lyophilized powder forms are recommended, especially for commercial preparations .

  • Reconstitution: Proteins should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Avoiding degradation: Repeated freeze-thaw cycles should be strictly avoided, as they significantly reduce protein activity .

For P. falciparum sexual stage proteins specifically, buffer conditions may need optimization based on the specific protein. Many of these proteins are stored in Tris/PBS-based buffers with 6% trehalose at pH 8.0 to maintain stability .

What techniques are most effective for validating the correct folding of recombinant P. falciparum sexual stage proteins?

Multiple complementary techniques should be used to assess protein folding:

  • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure elements (α-helices, β-sheets) and can be compared to predictions from AlphaFold models, which are now available for many P. falciparum proteins .

  • Intrinsic Fluorescence Spectroscopy: Measures the fluorescence of aromatic amino acids (primarily tryptophan), which is sensitive to the local environment and can indicate proper tertiary structure formation.

  • Antibody Recognition: Using conformation-specific antibodies that recognize epitopes only present in correctly folded proteins. This is particularly relevant for sexual stage proteins like Pfs230 and Pfs48/45, which contain disulfide-dependent conformational epitopes recognized by transmission-blocking antibodies .

  • Functional Assays: For example, PfCCp proteins can be assessed by their ability to bind to newly formed macrogametes but not to gametocytes or older macrogametes, as demonstrated using PfCCp-coated latex beads .

  • Protein-Protein Interaction Studies: Co-immunoprecipitation assays can verify if recombinant sexual stage proteins form expected complexes with partner proteins, as demonstrated for PfCCp proteins .

How can researchers effectively study protein-protein interactions involving P. falciparum sexual stage proteins?

Several methods are suitable for studying protein-protein interactions in P. falciparum:

  • Co-immunoprecipitation (Co-IP): This technique has been successfully used to demonstrate the formation of complexes involving PfCCp proteins in gametocyte lysates .

  • Affinity Chromatography Co-elution Binding Assays: These assays with recombinant domains can indicate direct binding between distinct adhesion domains, as shown for PfCCp proteins .

  • Complex Binding Assays: Using activated amino link plus coupling resin, proteins can be cross-linked to activated resin and used to test complex formation with potential binding partners. This approach has been used for studying interactions between PfSBP1-BR5, PfJ23, and ATS proteins .

  • Surface Plasmon Resonance (SPR): Provides quantitative binding kinetics and affinity measurements for protein-protein interactions.

  • Bead-Based Binding Assays: PfCCp-coated latex beads have been used to demonstrate stage-specific binding to macrogametes but not to gametocytes or older macrogametes .

When designing these experiments, it's crucial to include appropriate positive and negative controls, as exemplified in complex binding assays where PfSBP1-BR5-PfJ23 and PfJ23-ATS complex pairs were used as positive controls, while PfSBP1-BR5-ATS and unrelated protein pairs served as negative controls .

How are recombinant P. falciparum sexual stage proteins used in transmission-blocking vaccine development?

Recombinant sexual stage proteins play crucial roles in transmission-blocking vaccine (TBV) development:

  • Antigen Identification and Validation: Recombinant proteins allow researchers to identify potential vaccine candidates and validate their ability to induce transmission-blocking antibodies. This approach has been used for established TBV candidates like Pfs230 and Pfs48/45 .

  • Immunogen Design and Optimization: Various expression platforms have been used to produce soluble proteins, fusion antigens, long synthetic peptides (LSP), conjugates, and antigens arrayed on virus-like particles (VLPs) for vaccine development .

  • Epitope Mapping: Recombinant protein fragments help identify critical epitopes that elicit the most effective transmission-blocking antibodies. For example, studying isolated monoclonal antibodies reactive against Pfs48/45 and Pfs230 has advanced understanding of crucial epitopes .

  • Adjuvant Formulation Testing: Recombinant proteins formulated with different adjuvants can be tested in Phase I/II clinical trials to determine optimal formulations .

  • Immunogenicity Assessment: Recombinant proteins are used as coating antigens in ELISAs to measure antibody titers after vaccination and to assess antibody persistence.

  • Functional Assays: Standard membrane feeding assays (SMFA) using parasites expressing the same sexual stage proteins can evaluate the transmission-blocking activity of antibodies induced by recombinant protein vaccines.

What methods are used to evaluate the immunogenicity of recombinant P. falciparum sexual stage proteins?

Multiple complementary approaches are employed to assess immunogenicity:

  • Antibody Titer Measurements: Enzyme-linked immunosorbent assays (ELISAs) using the recombinant protein as coating antigen to measure antibody levels and isotype profiles.

  • Avidity Assays: Modified ELISAs using chaotropic agents to assess the strength of antibody-antigen binding, which correlates with functional activity.

  • Functional Assays:

    • Standard Membrane Feeding Assay (SMFA): The gold standard for assessing transmission-blocking activity

    • Direct Feeding Assay (DFA): Where mosquitoes feed directly on immunized animals or volunteers

    • Direct Skin Feeding Assay (DSFA): Measuring transmission reduction in field settings

  • B Cell Analysis: ELISpot assays to enumerate antigen-specific antibody-secreting cells and flow cytometry to characterize B cell responses.

  • T Cell Response Assessment: ELISpot assays measuring IFN-γ, IL-4, or IL-17 production by T cells stimulated with the recombinant proteins or peptide pools derived from them.

  • Target-Agnostic Methods: Innovative approaches like single B cell activation followed by high-throughput selection of human monoclonal antibodies reactive to sexual stages have been developed to identify naturally acquired antibody targets .

How can recombinant sexual stage proteins be used in diagnostic assays for malaria transmission potential?

Recombinant sexual stage proteins enable several diagnostic approaches:

  • Gametocyte Detection Assays: ELISAs using antibodies against sexual stage proteins can detect and quantify gametocytes in blood samples, providing information about transmission potential.

  • Serological Markers of Exposure: Measuring antibodies against sexual stage proteins in human populations can serve as a proxy for recent gametocyte exposure and transmission intensity in a community.

  • Multiplex Bead-Based Assays: Coupling different recombinant sexual stage proteins to microspheres with distinct fluorescent signatures allows simultaneous measurement of antibodies against multiple transmission-stage antigens.

  • Lateral Flow Assays: Point-of-care tests incorporating recombinant sexual stage proteins can detect gametocyte-specific antibodies or antigens in field settings without sophisticated laboratory equipment.

  • Molecular Beacon Assays: Combining recombinant proteins with molecular approaches for sensitive detection of low-density gametocyte infections that contribute significantly to transmission.

These diagnostic approaches are particularly valuable for malaria elimination programs, where identifying the human infectious reservoir is crucial for targeted interventions.

How do epigenetic mechanisms regulate expression of P. falciparum sexual stage-specific proteins, and how can this be studied using recombinant proteins?

Epigenetic regulation of sexual stage proteins involves several mechanisms:

  • Heterochromatin Dynamics: Studies show that heterochromatin distribution changes during sexual development. The transgenic parasite line E5ind, which enables controlled massive sexual conversion, has revealed that heterochromatin distribution is almost identical between asexual blood stages, sexual rings, and stage I gametocytes, suggesting that major changes occur later in development .

  • Histone Modifications: Sexual stage protein genes are often regulated by specific histone modifications that change during development from asexual to sexual stages.

  • Transcription Factors: Proteins like PfAP2-G act as master regulators of sexual development, with their expression controlled by epigenetic mechanisms.

Recombinant proteins can be used to study these mechanisms through:

  • Chromatin Immunoprecipitation (ChIP) Assays: Using recombinant PfAP2-G proteins and antibodies raised against them to identify binding sites in the genome related to sexual stage protein regulation.

  • Protein-Protein Interaction Studies: Identifying interactions between recombinant sexual stage proteins and chromatin modifiers to understand regulatory networks.

  • DNA-Protein Binding Assays: Using recombinant transcription factors to determine binding specificity to promoter regions of sexual stage protein genes.

  • Reporter Assays: Developing systems where recombinant proteins act as sensors for epigenetic states in parasite cultures.

The E5ind transgenic line, which allows activation of PfAP2-G expression via rapamycin induction resulting in ~90% sexual conversion, represents a valuable tool for studying the temporal dynamics of epigenetic changes during sexual development .

What approaches can resolve contradictions in protein structure-function relationships for P. falciparum sexual stage proteins?

Resolving structural and functional contradictions requires integrated approaches:

How can researchers design optimal recombinant constructs of P. falciparum sexual stage proteins for structural studies and drug development?

Optimal construct design requires consideration of multiple factors:

  • Domain Boundary Optimization: Careful analysis of predicted domain boundaries using bioinformatics tools and AlphaFold models to avoid disrupting functional domains. For P. falciparum proteins, which often have unique domain architectures, this is particularly important .

  • Expression Tag Selection and Placement: Strategic placement of purification tags (e.g., His, GST, MBP) to minimize interference with protein folding or function. For sexual stage proteins with complex domain arrangements, testing both N- and C-terminal tags may be necessary.

  • Codon Optimization: Customizing codon usage for the expression host while maintaining key regulatory elements that might affect protein folding kinetics.

  • Solubility Enhancement: Incorporating solubility-enhancing fusion partners or mutations based on structural prediction.

  • Crystallization Construct Screening: Creating a panel of constructs with systematic variations in termini and surface residues to identify optimal constructs for crystallization.

  • Surface Entropy Reduction: Identifying and mutating surface clusters of high entropy residues (usually lysine and glutamate) to alanine to promote crystal contacts.

  • Disulfide Engineering: Strategically introducing disulfide bonds to stabilize flexible regions that might hinder crystallization or structural studies.

  • Ligand Co-expression or Addition: Including known ligands or binding partners during expression or purification to stabilize the protein structure.

  • AlphaFill-Guided Design: Using the AlphaFill database to identify potential ligand "transplants" based on homology of AlphaFold structures to known structures, which can guide construct design for drug discovery purposes .

For drug development specifically, focusing on proteins with evidence of druggability from multiple sources (AlphaFill predictions, orthology to known drug targets, and enzyme class information) increases the likelihood of success .

What strategies can overcome expression difficulties for challenging P. falciparum sexual stage proteins?

Several specialized approaches can address common expression challenges:

  • Fusion Partner Screening: Testing multiple fusion partners (MBP, GST, SUMO, TrxA) to enhance solubility. MBP has been particularly successful for many Plasmodium proteins.

  • Expression Temperature Optimization: Lower temperatures (16-20°C) often improve folding of P. falciparum proteins by slowing synthesis and allowing more time for proper folding.

  • Co-expression with Chaperones: Co-expressing with chaperone systems like GroEL/GroES or DnaK/DnaJ/GrpE can improve folding of difficult proteins.

  • Specialized E. coli Strains: Using strains like SHuffle or Origami that have oxidizing cytoplasmic environments to facilitate disulfide bond formation in sexual stage proteins rich in disulfide bridges.

  • Cell-Free Expression Systems: These can be valuable for toxic proteins that inhibit host cell growth when expressed conventionally.

  • Expression Construct Optimization: Testing multiple constructs with varying N- and C-terminal boundaries to identify the most expressible form.

  • Inclusion Body Recovery: For proteins that form inclusion bodies despite optimization attempts, developing refolding protocols using high-throughput screening of refolding conditions.

  • Alternative Expression Hosts: For particularly challenging proteins, transitioning to eukaryotic systems like baculovirus-infected insect cells or mammalian cells.

  • Codon Harmonization: Rather than simple codon optimization, maintaining the relative codon usage frequency pattern of the native gene in the expression host.

  • Supplementing with Rare tRNAs: Using E. coli strains that supply rare codons (e.g., Rosetta strains) or co-expressing rare tRNA genes.

How can researchers validate that their recombinant P. falciparum sexual stage proteins accurately represent native parasite proteins?

Multiple validation approaches should be employed:

What are the most effective approaches for studying the role of post-translational modifications in P. falciparum sexual stage proteins?

Post-translational modifications (PTMs) in P. falciparum sexual stage proteins can be studied through:

  • Mass Spectrometry-Based Profiling: High-resolution mass spectrometry to identify and quantify PTMs in native parasite proteins as a reference for recombinant versions.

  • Expression in Eukaryotic Systems: Using expression systems capable of performing relevant PTMs for P. falciparum proteins, such as glycosylation, phosphorylation, and proteolytic processing.

  • Site-Directed Mutagenesis: Systematically mutating predicted PTM sites to assess their functional importance.

  • PTM-Specific Antibodies: Generating antibodies that specifically recognize modified forms of the proteins to track PTMs during parasite development.

  • In Vitro Modification Systems: Reconstituting modification systems in vitro using recombinant modifying enzymes and substrate proteins.

  • Chemical Biology Approaches: Using bio-orthogonal chemistry to specifically label and track modified proteins in parasites.

  • Comparative PTM Profiling: Comparing PTM patterns between different parasite life stages to identify stage-specific modifications critical for sexual stage protein function.

  • PTM-Mimetic Mutations: Introducing mutations that mimic constitutive modifications (e.g., phosphomimetic mutations) to assess functional consequences.

  • Inhibitor Studies: Using specific PTM enzyme inhibitors to assess the impact on protein function and parasite development.

  • Temporal Dynamics Analysis: Tracking changes in PTMs during sexual development using pulse-chase experiments combined with immunoprecipitation and mass spectrometry.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.