Recombinant Plasmodium falciparum Uncharacterized J domain-containing protein PF14_0013 (PF14_0013)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if different. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Please inform us in advance; additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
PF14_0013; Uncharacterized J domain-containing protein PF14_0013
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-492
Protein Length
full length protein
Species
Plasmodium falciparum (isolate 3D7)
Target Names
PF14_0013
Target Protein Sequence
MSNRQSIDDMNLSVKNKKSKSIFSCRPVKYVCLSVAVAAVGYANYMNNGDRNSLSCVDLN NVYSRNLSESQENHNSSFTRTNLVENENEEDDIFGVHRDESFAETVLNGQDIISYLEHQN TKIHEDNIHDDISHTLLNEGDVQNYYDVLNVNEHSDLNELKRNFHNLSLQHYPKITSDNS FELNDEFNQLSEAYQVLSYQIRKNIYDNEGVYGTKKMAIVNPLIYFNGIFTTQLMHEYIG TTEVAQFVQLFLERNIAPENIVSFLEESVSDMMKGQDYRELQLTELLKQKLDLYINDDEK WQNIIKSEINVLTKSPFSKFILEAVGWTYENVGNIYMEQTDNFDNVYHGIYVNLADERIN RNYAILDENVNDFVSLLKKFYPFTETVNPYLRRAKHNLNNLQGGINNLYSSVNVVYDNLF NENINISSNEHYHLLQELLKIILNINLCDIEETIRECAYNVLKDKTVDASVHSKRAHRMN ILGSLMLESSNE
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the predicted subcellular localization of PF14_0013?

Bioinformatic prediction analyses suggest that PF14_0013 is primarily localized to the nucleus of P. falciparum . This nuclear localization pattern is significant as it suggests potential involvement in nuclear processes such as gene expression regulation, DNA replication, or maintenance of protein quality control within the nucleus. The predicted nuclear localization differentiates it from some other J domain-containing proteins in P. falciparum that localize to different cellular compartments such as the endoplasmic reticulum, mitochondria, or plasma membrane .

How does PF14_0013 compare to other J domain-containing proteins in P. falciparum?

P. falciparum expresses numerous J domain-containing proteins with diverse subcellular localizations and functions. The table below compares PF14_0013 with several other J domain-containing proteins:

Protein IDPredicted LocalizationKnown InteractionsFunction (if known)
PF14_0013Nucleus Not well characterizedUncharacterized
PF14_0700Nucleus PfHsp70, PfHsp90, membrane/exported proteins Potential co-chaperone in Hsp90 complex
PF14_0324Not specifiedPfHsp90, PfHsp70, falcipain-2 precursor Potential Hsp90-Hsp70 adaptor
PF11_0513Nucleus/cytoplasm Not specifiedNot well characterized
PF08_0115Nucleus Not specifiedNot well characterized

While specific information about PF14_0013's interactions is limited, the functional characterization of other J domain-containing proteins provides valuable insights into its potential roles.

What is the general role of J domain-containing proteins in P. falciparum?

J domain-containing proteins (Hsp40s) play crucial roles in the cellular biology of P. falciparum:

  • They function as co-chaperones that regulate the ATPase activity of Hsp70 molecular chaperones, enhancing their ability to bind and release substrate proteins .

  • They direct Hsp70 chaperones to specific substrate proteins or cellular locations, providing specificity to the chaperone system.

  • They participate in protein folding, preventing protein aggregation during stress conditions that the parasite experiences during its complex life cycle .

  • They assist in protein translocation across cellular membranes, which is particularly important for a parasite that extensively modifies its host cell.

  • They form part of multi-chaperone complexes, working in concert with Hsp70 and Hsp90 to maintain protein homeostasis .

For example, PF14_0700, another J domain-containing protein, interacts with both PfHsp70 and PfHsp90, suggesting its function as a co-chaperone in the Hsp90 multi-chaperone complex. It also interacts with several membrane and exported parasite proteins, indicating potential roles in protein trafficking or quality control of exported proteins .

How might PF14_0013 participate in the P. falciparum chaperone network?

While specific data on PF14_0013's interactions remain limited, its classification as a J domain-containing protein suggests several probable mechanisms within the parasite's chaperone network:

  • As a nuclear-localized J domain protein, PF14_0013 likely interacts with nuclear-localized Hsp70 chaperones to facilitate protein folding, assembly of complexes, or quality control within the nucleus.

  • The protein may participate in stress response mechanisms, particularly those affecting nuclear processes during the parasite's developmental stages.

  • It could function in a manner similar to PF14_0324, which exhibits homology to human Hop and serves as an adaptor linking Hsp90 and Hsp70 into a multi-chaperone complex .

  • Its nuclear localization suggests potential involvement in chromatin remodeling, transcriptional regulation, or DNA repair mechanisms, all of which require chaperone assistance.

Systems analysis of chaperone networks in P. falciparum has revealed complex interconnections between different chaperone families, with J domain-containing proteins playing key roles in these networks .

What are the optimal approaches for recombinant expression and purification of PF14_0013?

Based on established protocols for similar proteins, a comprehensive strategy for recombinant expression and purification of PF14_0013 involves:

  • Gene synthesis or amplification: Either synthesize the gene with codon optimization for the expression system or amplify it from P. falciparum genomic DNA using specific primers. For example, the following primer design approach could be used:

    • Forward primer containing an appropriate restriction site (e.g., NheI) followed by the 5' sequence of PF14_0013

    • Reverse primer with a restriction site (e.g., BamHI) and a His-tag sequence for purification

  • Expression vector selection: Clone the amplified fragment into an expression vector such as pET-11a with a T7 promoter for bacterial expression . The plasmid should include appropriate tags (His-tag, GST, etc.) for purification.

  • Expression system optimization: For P. falciparum proteins, E. coli BL21(DE3) is commonly used, but consider alternative systems if expression is problematic:

    • Test different temperatures (16°C, 25°C, 37°C)

    • Vary IPTG concentrations (0.1-1.0 mM)

    • Consider specialized strains expressing rare tRNAs

    • For problematic expression, consider yeast or insect cell systems

  • Purification strategy: Implement a multi-step purification process:

    • Initial capture using affinity chromatography (Ni-NTA for His-tagged proteins)

    • Further purification using ion exchange chromatography

    • Final polishing with size exclusion chromatography

    • Use optimized buffers with stabilizing additives (glycerol, arginine)

  • Quality assessment: Validate the purified protein through:

    • SDS-PAGE for purity analysis

    • Western blotting for identity confirmation

    • Mass spectrometry for exact mass determination and sequence verification

    • Circular dichroism for secondary structure confirmation

The storage buffer should be optimized, potentially including 50% glycerol and appropriate buffer components to ensure stability during storage at -20°C or -80°C .

What are the key considerations for designing proteomic experiments involving PF14_0013?

Effective proteomic analysis of PF14_0013 requires careful experimental design:

  • Define clear objectives and hypothesis: Clearly articulate whether you are studying interaction partners, post-translational modifications, or expression patterns of PF14_0013 under different conditions .

  • Sample preparation optimization:

    • For cultured parasites, ensure synchronization to specific developmental stages

    • Implement rapid freezing methods to preserve protein integrity

    • Consider subcellular fractionation to enrich nuclear proteins where PF14_0013 is predicted to localize

    • Proper lysis conditions to solubilize nuclear proteins while maintaining interactions

  • Appropriate controls and replication:

    • Include biological replicates (minimum of 3) to account for biological variability

    • Incorporate technical replicates to assess method reproducibility

    • Implement proper controls for antibody specificity and pull-down efficiency

    • Consider label-free versus labeled quantification approaches based on experimental questions

  • Data acquisition strategy:

    • For interaction studies, optimize immunoprecipitation conditions or proximity labeling approaches

    • For global proteomics, select appropriate fractionation methods to reduce sample complexity

    • Consider targeted versus untargeted mass spectrometry approaches based on research questions

  • Statistical analysis planning:

    • Determine sample size requirements for statistical power before beginning experiments

    • Plan for appropriate normalization strategies

    • Establish criteria for significance in quantitative comparisons

  • Validation strategy:

    • Plan orthogonal methods to validate mass spectrometry findings

    • Consider functional assays to assess biological significance of identified interactions

The execution should follow a systematic workflow as outlined by Protavio (2024): defining objectives, selecting appropriate methodologies, implementing rigorous sample preparation, acquiring high-quality data, and applying robust statistical analysis .

What advanced techniques can be applied to characterize PF14_0013 function?

Several sophisticated methodologies can be employed to elucidate PF14_0013 function:

  • CRISPR-Cas9 gene editing: Generate knockout or conditional knockout parasite lines to assess the essentiality and functional impact of PF14_0013. Additionally, introduce epitope tags for localization and interaction studies, or specific mutations to assess structure-function relationships.

  • Proximity-dependent biotin identification (BioID): Fuse PF14_0013 with a promiscuous biotin ligase to identify proximal proteins in living parasites, providing a snapshot of the protein's interaction neighborhood within its native nuclear environment.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map structural dynamics and protein-protein interaction interfaces of PF14_0013, particularly focusing on the J-domain and its interactions with Hsp70 partners.

  • Crosslinking mass spectrometry (XL-MS): Identify specific interaction sites between PF14_0013 and its binding partners through chemical crosslinking followed by mass spectrometry analysis.

  • Live-cell imaging with split fluorescent proteins: Visualize interactions between PF14_0013 and potential partners in real-time within living parasites using complementation-based approaches.

  • Thermal proteome profiling: Assess thermal stability changes of PF14_0013 under different conditions or in the presence of potential binding partners or small molecules.

  • Transcriptomics combined with proteomics: Implement multi-omics approaches to understand the impact of PF14_0013 manipulation on global gene expression and protein abundance patterns .

  • Protein domain mapping: Express truncated versions of PF14_0013 to identify minimal functional regions required for specific interactions or activities, similar to approaches used for PfRH4 characterization .

How might PF14_0013 contribute to parasite stress response mechanisms?

As a J domain-containing protein potentially involved in the chaperone network, PF14_0013 may play critical roles in P. falciparum stress responses:

  • Temperature fluctuation adaptation: The parasite experiences significant temperature variations during fever cycles in the human host. Nuclear-localized chaperones like PF14_0013 may protect temperature-sensitive nuclear processes such as DNA replication and transcription.

  • Oxidative stress management: During intraerythrocytic development, P. falciparum faces oxidative stress from hemoglobin degradation. Nuclear chaperones could protect genome integrity and transcription machinery from oxidative damage.

  • Developmental transition support: The complex life cycle of P. falciparum involves dramatic transcriptional changes during stage transitions. PF14_0013 may facilitate the proper folding and assembly of transcription factors and chromatin remodeling complexes during these transitions.

  • Antimalarial drug response: Studies have suggested connections between chaperone networks and drug resistance mechanisms in P. falciparum. For example, PF10_0242, a PgP-like ABC transporter potentially involved in drug resistance, has been linked to the parasite's chaperone network .

To investigate these potential roles, researchers could:

  • Compare PF14_0013 expression levels across developmental stages and stress conditions

  • Analyze the effects of PF14_0013 knockdown on parasite survival under various stresses

  • Identify changes in the PF14_0013 interactome during stress conditions

  • Assess the impact of PF14_0013 manipulation on resistance to antimalarial compounds

What is the potential relationship between PF14_0013 and other chaperone systems in P. falciparum?

The relationship between PF14_0013 and broader chaperone systems in P. falciparum represents a complex research area:

  • Integration with the Hsp70-Hsp90 axis: Systems analysis of chaperone networks in P. falciparum reveals complex interactions between Hsp40s, Hsp70s, and Hsp90. PF14_0013 may function similarly to PF14_0700, which interacts with both PfHsp70 and PfHsp90, potentially serving as a co-chaperone in multi-chaperone complexes .

  • Specialized nuclear functions: Being nuclear-localized, PF14_0013 likely collaborates with nuclear-specific chaperones to maintain nuclear proteostasis. It may interact with proteins like PF11_0509 or PF11_0513, which are also predicted to have nuclear localization .

  • Potential adaptor functions: Similar to PF14_0324, which exhibits homology to human Hop (an Hsp70-Hsp90 adaptor), PF14_0013 might serve as an adaptor linking different chaperone systems within the nucleus .

  • Role in exported protein quality control: Some J domain proteins in P. falciparum are involved in the trafficking and quality control of exported proteins. While PF14_0013 is predicted to be nuclear, it could potentially be involved in the quality control of proteins destined for export before they leave the nucleus .

Experimentally, these relationships could be investigated through:

  • Systematic co-immunoprecipitation studies coupled with mass spectrometry

  • Yeast two-hybrid or three-hybrid screening for interaction partners

  • Comparative analysis of phenotypes resulting from manipulation of different chaperone components

How can contradictory data in PF14_0013 research be resolved through improved experimental design?

When confronting contradictory findings in PF14_0013 research, systematic approaches to experimental design can help resolve discrepancies:

  • Standardization of parasite strains and culture conditions: Different P. falciparum strains may express varying levels of PF14_0013 or exhibit different protein-protein interactions. Researchers should:

    • Clearly document the parasite strain used (e.g., 3D7, Dd2)

    • Standardize culture conditions across experiments

    • Consider strain-specific variations when interpreting results

  • Protein tagging strategy considerations: Different tagging approaches can affect protein function and localization:

    • Compare N-terminal versus C-terminal tagging results

    • Validate that tags don't disrupt J domain function or protein interactions

    • Use multiple tagging strategies to confirm results

  • Temporal expression analysis: P. falciparum proteins often show stage-specific expression:

    • Ensure tight synchronization of parasites for comparative studies

    • Document the precise developmental stage when samples are collected

    • Consider time-course experiments to capture dynamic changes

  • Methodological triangulation: Apply multiple methods to address the same question:

    • Combine genetic, biochemical, and cell biological approaches

    • Use both in vitro and in vivo methods when possible

    • Implement orthogonal techniques to validate key findings

  • Quantitative considerations:

    • Ensure sufficient statistical power through appropriate sample sizes

    • Implement rigorous quantification methods with proper controls

    • Use standardized reporting formats for proteomics data

  • Collaborative verification: Consider multi-laboratory validation for controversial findings, with standardized protocols and reagent sharing to ensure reproducibility.

What implications does PF14_0013 research have for antimalarial drug development?

Research on PF14_0013 has several potential implications for antimalarial drug development:

  • Novel drug target identification: As part of the essential chaperone network, PF14_0013 itself or its interactions could represent novel drug targets. Chaperone systems are increasingly recognized as important targets in various diseases, including parasitic infections.

  • Resistance mechanism understanding: Chaperone networks in P. falciparum have been implicated in drug resistance mechanisms. For example, studies have shown connections between PfHsp90 and drug resistance-associated proteins like the PgP-like ABC transporter PF10_0242 . Understanding PF14_0013's potential role in these networks could provide insights into resistance mechanisms.

  • Combination therapy strategies: If PF14_0013 is involved in stress response pathways, inhibiting its function could potentially sensitize parasites to existing antimalarials, suggesting possible combination therapy approaches.

  • Parasite-specific targeting: The divergence between parasite and human J domain proteins could potentially be exploited for selective targeting. Structural and functional characterization of PF14_0013 could reveal parasite-specific features amenable to selective inhibition.

  • Phenotypic screening applications: Understanding the cellular consequences of PF14_0013 disruption could inform the development of cellular assays for phenotypic drug screening, potentially identifying compounds that indirectly affect its function or its interaction network.

  • Biomarker development: If PF14_0013 expression or modification status correlates with drug sensitivity or resistance, it could potentially serve as a biomarker for predicting treatment outcomes.

Experimental approaches to explore these possibilities include:

  • Screening for small molecule inhibitors of PF14_0013 J domain function

  • Testing the effects of PF14_0013 knockdown on sensitivity to existing antimalarials

  • Structural studies to identify parasite-specific features for selective targeting

  • Comparative analysis of PF14_0013 expression or modifications in drug-sensitive versus resistant parasite lines

What are the most promising research directions for PF14_0013?

Based on current knowledge and technical capabilities, several research directions for PF14_0013 show particular promise:

  • Comprehensive interactome analysis: Employing proximity labeling methods coupled with quantitative proteomics to identify the complete set of PF14_0013 interaction partners across different parasite stages and stress conditions.

  • Structural characterization: Determining the three-dimensional structure of PF14_0013, particularly focusing on its J domain and how it interacts with Hsp70 partners, using techniques such as cryo-electron microscopy or X-ray crystallography.

  • Functional genomics approaches: Implementing conditional knockdown or knockout systems to assess the essentiality of PF14_0013 across the parasite life cycle and identify stage-specific functions.

  • Dynamic regulation studies: Investigating how post-translational modifications regulate PF14_0013 function under different conditions, potentially revealing mechanisms of chaperone network modulation.

  • Comparative analysis across Plasmodium species: Examining orthologs of PF14_0013 in other Plasmodium species to understand conserved functions and species-specific adaptations in this protein family.

These research directions should be pursued using the experimental design principles and advanced methodologies discussed throughout this FAQ, with careful attention to reproducibility, validation, and biological relevance.

How can researchers contribute to the collective understanding of PF14_0013?

The scientific community can advance knowledge of PF14_0013 through several collaborative approaches:

  • Data sharing and standardization: Depositing raw data from proteomics experiments in public repositories with detailed metadata following established guidelines for proteomics data reporting .

  • Reagent development and distribution: Generating and sharing high-quality reagents such as antibodies, recombinant proteins, and transgenic parasite lines to facilitate reproducible research.

  • Interdisciplinary collaboration: Forming collaborations between parasitologists, structural biologists, systems biologists, and drug development researchers to address complex questions about PF14_0013 function.

  • Method optimization sharing: Publishing detailed protocols and method optimizations to enable others to build upon successful approaches for studying challenging proteins like PF14_0013.

  • Integration with large-scale datasets: Incorporating findings about PF14_0013 into broader resources such as malaria genome databases, protein interaction networks, and expression atlases to provide context for individual discoveries.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.