Recombinant Plasmodium falciparum Uncharacterized protein PFA0635c (PFA0635c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PFA0635c; Uncharacterized protein PFA0635c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-584
Protein Length
full length protein
Species
Plasmodium falciparum (isolate 3D7)
Target Names
PFA0635c
Target Protein Sequence
MKNIKNMKNIKSEGFIFFVLVFFICIIFGCIYESLHEGPYKKTLNSLHESTKYRHFNKIR LLTEYKDTLQIKVEQKSLRDYVNNDRYNNVNTNDYTSYKDKGEQFNDTICVVDKKKENVT INNEEECNKNFYQYLQYLEHNNKQDNKYEETNYFLQGNDKHIDSEHNGINKMYKETIHKT LTSDVSTENSYTHNNSRDDEPQNGKRTYNNQSNNNLPYDNSSYNISPYHGPNNNVPYNKS NNFEQCNTQDNKHCNDLDTYHTCYGPDNYPQKYDNYRQECDNYRQECDNYRQEYDNYPQK YDNYRQECDNYRQEYDNYPHGFDNYPRGFDNYPHGYDNHPHRPHIYPHGFDNHPHRPHMY PHNFPMRNESVGGPYYRPPHIIERSNYYKNPKKAPHNMMLPCDTMKDNKSICDEQNFQRE LEKIIKKNNLQNGNIRDNHDTRINDYNKRLTEYNKRLTEYNKRLTEYTKRLNEHYKRNGY NIQNRQNSIERAQSNDVVLYGHNFQNAFRYKQNTRSYYPHVNSNEATHHQKTMYFTQQNN YSREEYPIKSEQHLYHVKSKRLEKKLYDYQNGTNPVTNFLERHF
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is PFA0635c protein in Plasmodium falciparum?

PFA0635c is an uncharacterized protein in Plasmodium falciparum, the causative agent of the most severe form of malaria. It is a full-length protein consisting of 584 amino acids that has been recombinantly expressed with an N-terminal His tag in E. coli expression systems . Like many P. falciparum proteins, it remains functionally uncharacterized, representing part of the approximately one-third of P. falciparum genes that lack annotations regarding their function .

How is recombinant PFA0635c protein typically expressed and purified?

Recombinant PFA0635c is commonly expressed in E. coli expression systems with an N-terminal His tag to facilitate purification . The methodological approach follows standard recombinant protein procedures:

  • Clone the PFA0635c gene into an expression vector with a His-tag sequence

  • Transform the construct into an E. coli expression strain

  • Induce protein expression using IPTG or auto-induction

  • Lyse cells under native or denaturing conditions depending on protein solubility

  • Purify using nickel affinity chromatography

  • Verify purity by SDS-PAGE (>90% purity can be achieved)

  • Perform additional purification steps if necessary (size exclusion, ion exchange)

What structural prediction methods are useful for uncharacterized P. falciparum proteins like PFA0635c?

For structural prediction of uncharacterized proteins like PFA0635c, researchers can employ a multi-faceted approach:

  • Use AlphaFold predictions to generate potential structural models

  • Apply the DALI search algorithm to compare predicted structures with experimentally determined protein structures in the Protein Data Bank

  • Validate low-scoring similarities (bottom 5%) using the size-independent TM-align algorithm, which has shown to confirm detected similarities in 88% of cases

  • Look for structural resemblances to known domains, which can provide insights into potential functions

This approach has successfully identified similarities to known domains in 353 previously uncharacterized P. falciparum proteins, suggesting it could be valuable for characterizing PFA0635c .

How can immunogenicity of recombinant P. falciparum proteins like PFA0635c be evaluated?

Immunogenicity evaluation of recombinant P. falciparum proteins involves several key methodological steps:

  • Fragment Selection: For large proteins like PFA0635c, create smaller fragments based on conserved regions and predicted structural elements

  • Immunization Protocol: Immunize mice with purified recombinant protein fragments using appropriate adjuvants

  • Antibody Titer Analysis: Determine antibody titers using ELISA (endpoint titers can range from 1:10,000 to 1:5,120,000)

  • Antibody Affinity Assessment: Measure antibody affinity using methods like thiocyanate elution, with high-affinity antibodies showing >90% retention under stringent conditions

  • Recognition Analysis: Test whether the antibodies recognize both the recombinant protein and the native protein in parasite lysates

  • Functional Assays: Evaluate if the antibodies inhibit parasite invasion of erythrocytes in vitro

Based on studies with other P. falciparum proteins, well-designed immunogenicity experiments can identify fragments with both high antibody titers and functional inhibitory activity.

What in vitro assays can be used to assess the potential role of PFA0635c in P. falciparum invasion?

To evaluate the potential role of PFA0635c in P. falciparum invasion, researchers can implement several experimental approaches:

  • Invasion Inhibition Assay:

    • Culture P. falciparum (typically 3D7 strain) with erythrocytes in the presence of anti-PFA0635c antibodies at various dilutions

    • Include controls: preimmune sera (negative control) and heparin (positive control)

    • Quantify parasitemia by microscopy or flow cytometry

    • Calculate inhibition rates relative to controls

    • Test dose-dependency by using multiple antibody dilutions (e.g., 1:10, 1:100, 1:1000)

  • Erythrocyte Binding Assay:

    • Express recombinant fragments of PFA0635c

    • Incubate with erythrocytes and detect binding using specific antibodies

    • Confirm specificity through competition assays

  • Localization Studies:

    • Use immunofluorescence microscopy to determine the localization of PFA0635c during the invasion process

    • Co-stain with markers of known invasion-related compartments

These methodologies can provide evidence for functional roles in erythrocyte invasion, similar to what has been observed for other P. falciparum proteins like PfSRA, which showed dose-dependent inhibition rates of 24-31% .

How should researchers interpret structural similarities between PFA0635c and known protein domains?

When analyzing structural similarities between PFA0635c and known protein domains, researchers should follow this interpretative framework:

  • Evaluate Statistical Significance:

    • Z-scores above 2 in DALI searches indicate significant structural similarity

    • TM-align scores >0.5 suggest similar fold

  • Assess Coverage and Alignment Quality:

    • Determine what percentage of the protein is covered by the structural similarity

    • Examine the RMSD (root-mean-square deviation) of superposed structures

  • Function Prediction Analysis:

    Analysis ApproachApplication to PFA0635cInterpretive Value
    Conserved DomainsIdentify known domainsHigh (direct functional implication)
    Repeat StructuresDetect structural motifs like heptatricopeptide repeatsMedium (suggests RNA binding/processing)
    Binding PocketsPredict potential ligand binding sitesMedium (implies biochemical function)
    Surface PropertiesAnalyze electrostatic potentialLow (general biochemical behavior)
  • Validation Approaches:

    • Conduct sequence-based analyses to complement structural predictions

    • Perform experimental validation of predicted functions

    • Compare with orthologs in other Plasmodium species

Researchers should recognize that structural similarity doesn't necessarily indicate identical function but provides testable hypotheses about potential molecular roles.

What cellular immune response analyses are relevant for recombinant P. falciparum proteins?

When analyzing cellular immune responses to recombinant P. falciparum proteins like PFA0635c, researchers should consider:

  • Lymphocyte Proliferation Assays:

    • Isolate lymphocytes from immunized animals

    • Stimulate with recombinant protein fragments

    • Measure proliferation using methods like [³H]-thymidine incorporation or CFSE dilution

    • Include positive controls (ConA) and negative controls (media only)

    • Statistical analysis should compare proliferation between immunized and control groups (p < 0.05 is considered significant)

  • T-cell Response Analysis:

    • Use flow cytometry to measure CD4⁺ and CD8⁺ T cell responses

    • Quantify IFN-γ production as a measure of Th1 response

    • Analysis should include:

      • Percentage of CD4⁺-IFN-γ⁺ and CD8⁺-IFN-γ⁺ cells

      • Mean fluorescence intensity of cytokine staining

      • Statistical comparison between immunized and control groups

The interpretation should consider that not all P. falciparum proteins elicit strong cellular responses, as demonstrated in studies where certain protein fragments showed no significant lymphocyte proliferation or changes in CD4⁺-IFN-γ and CD8⁺-IFN-γ levels compared to controls .

How can researchers determine if PFA0635c contains RNA-binding domains similar to heptatricopeptide repeats found in other P. falciparum proteins?

To investigate whether PFA0635c contains RNA-binding domains similar to heptatricopeptide repeats, researchers should employ a comprehensive analytical approach:

  • Structural Prediction and Analysis:

    • Generate structural models using AlphaFold

    • Analyze the models for α-solenoid structures characteristic of heptatricopeptide repeats

    • Look for arrangements of repeating α-helical motifs with a specific periodicity

  • Sequence-Based Identification:

    • Perform position-specific scoring matrix (PSSM) searches

    • Use specialized repeat detection algorithms like HHrepID or TPRpred

    • Apply relaxed parameters as heptatricopeptide repeats in Plasmodium may be divergent

  • Experimental Validation:

    • Express recombinant fragments of potential repeat regions

    • Conduct RNA binding assays using:

      • Electrophoretic mobility shift assays (EMSA)

      • Filter binding assays

      • RNA immunoprecipitation

    • Test binding to RNA from mitochondria and apicoplasts specifically

  • Comparative Analysis:

    • Compare with the over 70 P. falciparum proteins that contain domains resembling heptatricopeptide repeats

    • Assess conservation patterns across Plasmodium species

This multi-faceted approach can determine whether PFA0635c belongs to the expanded family of RNA-binding proteins in P. falciparum, which are particularly important in transcription in mitochondria and apicoplasts.

What strategies should be employed to validate the predicted function of PFA0635c in vivo?

For in vivo validation of PFA0635c function, researchers should implement a comprehensive strategy:

  • Gene Modification Approaches:

    • CRISPR-Cas9 gene editing to generate knockout or conditional knockdown parasites

    • Epitope tagging for localization and protein interaction studies

    • Allelic replacement to test the function of specific domains

  • Phenotypic Analysis:

    • Growth curve analysis across the complete life cycle

    • Stage-specific effects using synchronized cultures

    • Detailed morphological assessment using electron microscopy

    • Invasion efficiency measurements

    • Gametocyte formation and exflagellation

  • Omics-Based Validation:

    ApproachMethodologyExpected Outcome
    TranscriptomicsRNA-seq of knockout vs. wild-typeChanges in gene expression patterns
    ProteomicsCo-IP followed by mass spectrometryIdentification of interaction partners
    MetabolomicsLC-MS/MS of knockout vs. wild-typeMetabolic pathway alterations
    ChIP-seq or CLIP-seqIf DNA/RNA binding is predictedIdentification of binding targets
  • Complementation Studies:

    • Reintroduce wild-type or mutated versions of PFA0635c

    • Assess rescue of phenotype

    • Test structure-function relationships of specific domains

  • Cross-Species Validation:

    • Test orthologous proteins from other Plasmodium species

    • Perform heterologous expression in model organisms

These approaches provide robust validation of computational predictions and establish the biological significance of PFA0635c in P. falciparum.

How can researchers assess whether antibodies against PFA0635c confer protection against P. falciparum infection?

To evaluate the protective potential of anti-PFA0635c antibodies, researchers should implement a comprehensive assessment strategy:

  • In Vitro Protection Studies:

    • Perform invasion inhibition assays with multiple parasite strains

    • Conduct growth inhibition assays over multiple parasite life cycles

    • Implement antibody-dependent cellular inhibition (ADCI) assays with monocytes

    • Test antibody-dependent respiratory burst (ADRB) activity with neutrophils

  • Immunization and Challenge Models:

    • Immunize mice with recombinant PFA0635c fragments

    • Challenge with transgenic rodent malaria parasites expressing P. falciparum PFA0635c

    • Measure parasitemia, survival rates, and pathology

    • Analyze correlation between antibody titers and protection

  • Mechanism of Action Investigation:

    • Determine the exact stage of parasite inhibition (attachment, invasion, or development)

    • Investigate whether inhibition is complement-dependent

    • Analyze antibody isotypes and their correlation with protection

    • Determine if protection is F(ab)₂-mediated or Fc-dependent

  • Cross-Strain Protection Analysis:

    • Test efficacy against laboratory-adapted strains (3D7, Dd2, HB3)

    • Evaluate activity against clinical isolates from different geographical regions

    • Assess sequence polymorphism impact on protection

This comprehensive approach mirrors successful evaluations of other P. falciparum antigens and provides critical data for determining whether PFA0635c has potential as a vaccine candidate.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.