Recombinant Plasmodium falciparum Uncharacterized protein PFL0250w (PFL0250w)

Shipped with Ice Packs
In Stock

Description

Immunological Relevance in Malaria Research

A 2019 serological study in Burkina Faso evaluated IgG reactivity to PFL0250w in endemic populations :

Ethnic GroupMean IgG Intensity (log)p-value
Fulani6.06 (5.90–6.22)0.1532
Non-Fulani5.90 (5.76–6.04)

Despite moderate reactivity, PFL0250w showed no statistically significant difference between ethnic groups, unlike other antigens (e.g., MAL6P1.37, p < 0.001) . This suggests it is not a dominant target of natural immunity compared to well-characterized vaccine candidates like MSP3 or MSP2 .

Production and Applications

  • Expression Systems: Commercial variants are produced in E. coli or cell-free systems , with yields optimized for biochemical assays.

  • Research Use:

    • Antigenicity screening in malaria-endemic regions .

    • Structural studies to identify conserved epitopes for vaccine design .

  • Limitations: Functional studies are pending, and its role in parasite biology (e.g., erythrocyte invasion, immune evasion) remains unknown .

Comparative Analysis with Other Malaria Antigens

PFL0250w exhibits lower IgG reactivity than leading vaccine candidates:

AntigenMean IgG (Fulani)Mean IgG (Non-Fulani)p-value
PFL0250w (MR214)6.065.900.1532
MSP2_3D79.258.59<0.001
(NANP)₁₀7.817.03<0.001

Data adapted from .

Future Research Directions

  • Functional Characterization: Clarify its role in parasite lifecycle stages.

  • Vaccine Potential: Evaluate immunogenicity in animal models using recombinant constructs.

  • Structural Biology: Resolve 3D architecture to identify druggable sites or conserved epitopes .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PFL0250w; Uncharacterized protein PFL0250w
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-781
Protein Length
full length protein
Species
Plasmodium falciparum (isolate 3D7)
Target Names
PFL0250w
Target Protein Sequence
MSYNDGSEEENDSNTYIPDEKKKKKKKNNKNAYALINEVNYSQEDEQEVIHNTNSEDETS NRKGNGCVYSLSDQNVEDHIISLPEYLDLINNNNNNSNSYKMKKEKKKKKKKKKNQTDEE NMKNKKDHIYQNNITNQQNDIKNDYKKINHHNMNNKKNKIFCQDDQNIFNINHTFQIHET VQNNLIIPPSETCLASDIIQPSDTTQSNTYLNEATASQNDDNNNEDSSNEMGMFKKIFYR IKKIIVDKKGTPITNENDVDNDMCELNVMENNMNNIHSNNNNISTHMDDVIEDESNEEVF VINRNTDGYINTRENINVSTHVTRQMINLSELNPNDLLCNVSEYEEGQNINSLWNDNNNN NNNNNNNFLVGSLNALHPINHNLRNENIHNDNINNTHINYDNNNSYESPIHILSFSFKNI YNKISSYINEHITHIKEKIKKYWLERVQEANTQLNSPRPVHTRNTTNINTNININEDEND DPSCVQILFFMGLICKFPILWIIGSIVFCITPSEHRKTKTWSLVNTFFALLSIIYFITTT NFRLRKPTFFVILEQNVENKNTYPKGILKYNNMIHHKHIIIDQSSLHKWKDLHTNKVYKT SENYFLNRNFLSSQKPDSNILLSDTIYKLLNRIQVTVTFGKGNIYSSDNIEKIKPFFQNL RINMDPISYDKLTMTDEDIPDDFFGSGLRCERTYNNHNQNINEPQQNKEKEKWYLFWKEE EINNSHNKNIYNISIPVGEIFFFKSEYNCRIAFLYPKSILYDQNDIPSNFVEIQKIIIKP F
Uniprot No.

Target Background

Database Links

KEGG: pfa:PFL0250w

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Why should researchers study uncharacterized proteins like PFL0250w?

Uncharacterized proteins represent significant gaps in our understanding of Plasmodium falciparum biology. Studying PFL0250w could reveal:

  • Novel pathways crucial for parasite survival

  • Potential drug targets for therapeutic intervention

  • Insights into malaria pathogenesis mechanisms

  • Evolutionary adaptations specific to P. falciparum

The identification of novel malaria vaccine candidates often involves studying previously uncharacterized proteins, as demonstrated by approaches selecting α-helical coiled coil domains of proteins predicted in the parasite proteome .

How does PFL0250w fit within P. falciparum genomics research?

While PFL0250w's specific function remains unknown, quantitative trait loci (QTL) mapping studies have revealed important insights about regulatory pathways in P. falciparum. Such approaches have identified candidate genes involved in cell cycle regulation on chromosome 12, where other important regulatory proteins have been discovered . Similar methodologies could be applied to understand PFL0250w's role within the parasite's biology, especially given its uncharacterized status.

What expression systems yield optimal results for recombinant PFL0250w production?

Different expression systems offer distinct advantages for producing recombinant PFL0250w:

Expression SystemAdvantagesConsiderations
E. coliBest yields, shorter turnaround timesMay lack post-translational modifications
YeastGood yields, eukaryotic processingModerate complexity
Insect cellsProper post-translational modificationsLonger production time
Mammalian cellsMost native-like protein foldingMost complex, lower yields

E. coli systems represent the most efficient approach for initial studies, with the protein successfully expressed as an N-terminal His-tagged construct .

What purification strategies maximize PFL0250w yield and purity?

Optimal purification of recombinant PFL0250w involves:

  • Affinity chromatography using His-tag binding resins

  • Buffer optimization (Tris/PBS-based buffer, pH 8.0 with 6% Trehalose)

  • Careful aliquoting to avoid repeated freeze-thaw cycles

  • Storage at -20°C/-80°C for long-term stability

The purified protein typically achieves >90% purity as determined by SDS-PAGE analysis .

How should researchers handle reconstitution of lyophilized PFL0250w protein?

For optimal reconstitution of lyophilized PFL0250w:

  • Briefly centrifuge the vial before opening to collect contents at the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL concentration

  • Add glycerol to 5-50% final concentration for stability

  • Prepare small working aliquots for storage at 4°C (viable for up to one week)

  • Store remaining material at -20°C/-80°C

This approach minimizes protein degradation and maintains functional integrity for experimental use .

What bioinformatics methods can predict potential functions of PFL0250w?

Given PFL0250w's uncharacterized status, researchers should employ multiple computational approaches:

  • Sequence alignment with characterized proteins across species

  • Domain and motif identification using tools like Pfam, SMART, and ProSite

  • Secondary structure prediction (α-helices, β-sheets) using algorithms like PSIPRED

  • Tertiary structure modeling via homology modeling or AI-based prediction tools

  • Gene ontology term assignment based on structural features

These approaches can generate testable hypotheses about PFL0250w function.

Which experimental techniques best determine PFL0250w localization in P. falciparum?

Subcellular localization provides crucial functional insights through:

  • Immunofluorescence microscopy using anti-His antibodies (for recombinant protein) or custom antibodies against PFL0250w

  • Generation of GFP-fusion constructs for live-cell imaging

  • Subcellular fractionation followed by Western blot analysis

  • Co-localization studies with known compartment markers

  • Electron microscopy for high-resolution localization

P. falciparum culture techniques, including synchronization methods using sorbitol or magnetic activated cell sorting (MACS), enable stage-specific localization studies .

How can researchers investigate protein-protein interactions involving PFL0250w?

Understanding interaction networks is essential for functional characterization:

  • Co-immunoprecipitation with anti-tag antibodies followed by mass spectrometry

  • Yeast two-hybrid screening against P. falciparum cDNA libraries

  • Proximity-dependent biotinylation (BioID) in transgenic parasites

  • In vitro binding assays using recombinant PFL0250w

  • Computational prediction of interaction partners based on structural features

These methods can reveal functional associations and pathway involvement.

How might PFL0250w contribute to P. falciparum cell cycle and development?

Based on sequence features and P. falciparum biology, PFL0250w could potentially function in:

  • Regulation of parasite cell cycle progression

  • Host cell remodeling during intraerythrocytic development

  • Stress response mechanisms during environmental transitions

  • Protein synthesis or modification pathways

Quantitative trait loci studies have identified regulatory genes controlling P. falciparum cell cycle duration , and similar approaches could determine if PFL0250w affects parasite development rates.

What experimental design would assess PFL0250w as a potential therapeutic target?

A comprehensive target assessment workflow should include:

  • Gene disruption or conditional knockdown to determine essentiality

  • Phenotypic analysis across multiple parasite life stages

  • High-throughput screening against recombinant protein

  • Structural analysis to identify druggable pockets

  • In vivo validation in animal models

These approaches align with strategies used for identifying malaria vaccine candidates based on protein structural elements .

How can researchers differentiate between functional redundancy and unique roles when studying PFL0250w?

Addressing functional redundancy requires:

  • Comparative analysis with paralogous proteins in P. falciparum

  • Cross-species complementation experiments

  • Domain-specific mutagenesis to identify critical functional regions

  • Transcriptional profiling under various conditions

  • Double knockout/knockdown studies with related proteins

This systematic approach can distinguish unique versus redundant functions.

What genomic editing techniques are most appropriate for studying PFL0250w function?

State-of-the-art genetic approaches include:

  • CRISPR-Cas9 gene editing for precise modification

  • Selection-linked integration (SLI) for efficient tagging

  • Conditional knockdown systems (e.g., ribozyme switches, auxin-inducible degron)

  • Promoter replacement for expression timing studies

  • Allelic exchange to study specific domains

These techniques enable sophisticated functional analysis despite P. falciparum's challenging genetic manipulation.

How might seasonal variations in malaria transmission affect PFL0250w expression and function?

Recent research demonstrates that P. falciparum clones transmitted in different seasons show distinct survival patterns . Researchers investigating PFL0250w should consider:

  • Comparing expression levels between dry and wet season isolates

  • Assessing functional differences in proteins expressed during different seasons

  • Studying protein-protein interactions under varying environmental conditions

  • Evaluating post-translational modifications that might vary seasonally

  • Examining strain-specific variations in PFL0250w sequence and expression

Such studies could reveal adaptations to seasonal pressures and transmission dynamics.

What are the critical considerations for experimental design when studying PFL0250w in different P. falciparum life stages?

Life-stage specific analysis requires careful experimental planning:

Life StageCulture ConditionsAnalytical ApproachesSpecial Considerations
RingSorbitol synchronizationFlow cytometry, RNA-seqRapid development (0-24h)
TrophozoiteRPMI 1640 with Albumax II or plasmaProteomics, MicroscopyActive metabolism (24-36h)
SchizontGelafundin enrichment for knob-positive iRBCElectron microscopy, Protein expressionMultinucleated stage (36-48h)
MerozoiteMechanical rupture of schizontsInvasion assays, Surface labelingShort-lived, invasive form

Maintaining physiological conditions (5% O₂, 5% CO₂, 90% N₂) is essential for all stages, as is the choice between Albumax II supplementation versus human plasma, which can affect parasite development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.