Recombinant Platanus occidentalis NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Platanus occidentalis NAD(P)H-Quinone Oxidoreductase Subunit 3, Chloroplastic (ndhC)

Recombinant Platanus occidentalis NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is a protein expressed in E. coli that functions as an enzyme catalyzing the transfer of electrons from NAD(P)H to quinones . This protein, tagged with histidine (His), is associated with the NDH complex in the chloroplasts of Platanus occidentalis, also known as the American sycamore tree . The ndhC subunit is a component of the larger NAD(P)H dehydrogenase complex, which plays a crucial role in various electron transport pathways within the chloroplast .

Table 1: Properties of Recombinant Platanus occidentalis ndhC Protein

PropertyDescription
Cat. No.RFL33797PF
SpeciesPlatanus occidentalis (Sycamore)
SourceE. coli
TagHis
Protein LengthFull Length (1-120 amino acids)
FormLyophilized powder
AA SequenceMFLLHEYDIFWAFLIISSVIPILAFLISGVLAPISEGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVPVFIEALIFVLILIVGSVYAWRKGALEWS
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃.
Gene NamendhC
SynonymsndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
UniProt IDQ09G41

Function and Significance

The ndhC subunit is part of the NAD(P)H dehydrogenase complex (NDH), which is involved in electron transfer from NAD(P)H to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain . This complex is essential for:

  • Photosynthesis: Facilitating electron transport and maintaining the redox balance within the chloroplast .

  • Stress Response: Playing a role in protecting the photosynthetic machinery under stress conditions .

  • Metabolic Regulation: Influencing the accumulation of essential compounds like plastochromanol-8 and vitamin K1 .

Localization and Structure

The ndhC protein is localized in the chloroplasts, specifically within the thylakoid membranes, where it interacts with other subunits to form the functional NDH complex . Studies using GFP-fusion proteins and proteomic analyses have confirmed its presence in chloroplast lipid droplets (plastoglobules) .

Research Findings and Experimental Evidence

Table 2: Impact of NDC1 on Prenylquinone Metabolism in Arabidopsis

CompoundWild Typendc1 Mutant
Plastoquinone100%120%
Plastochromanol-8100%20%
Vitamin K1100%5%

Note: Values are expressed relative to the wild type.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Platanus occidentalis (Sycamore) (American plane tree)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWAFLIISSVIPILAFLISGVLAPISEGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVPVFIEALIFVLILIVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be plastoquinone. The reaction couples redox activity with proton translocation, conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) in Platanus occidentalis?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a protein-coding gene located in the chloroplast genome of Platanus occidentalis (American Sycamore). It encodes a subunit of the NAD(P)H dehydrogenase complex, which participates in cyclic electron transport around photosystem I. This complex is integral to the chloroplast electron transport chain and plays a role in photosynthetic efficiency, particularly under stress conditions. The gene is part of the conserved ndh gene family found in the chloroplast genomes of most land plants .

What are the functional domains of the ndhC protein and how do they contribute to NAD(P)H dehydrogenase activity?

The ndhC protein contains several transmembrane domains that anchor it within the thylakoid membrane, plus functional regions involved in cofactor binding and electron transfer. While specific structural information for P. occidentalis ndhC is limited, insights can be drawn from related NAD(P)H dehydrogenases. For example, in human NQO1 (which has a different evolutionary origin but similar function), the FAD binding domain plays a crucial role in electron transport . The chloroplastic ndhC likely contains domains specialized for interaction with other ndh subunits and integration into the larger NAD(P)H dehydrogenase complex. Functional studies typically employ site-directed mutagenesis to identify critical residues involved in quinone binding and electron transfer activities.

What expression systems are most effective for producing recombinant P. occidentalis ndhC protein?

For chloroplastic membrane proteins like ndhC, expression in prokaryotic systems often poses challenges due to the hydrophobic nature of transmembrane domains. Researchers should consider:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliCost-effective, high yieldInclusion body formation commonUse specialized strains (C41/C43); lower induction temperature (16-20°C)
Yeast (P. pastoris)Post-translational modifications, membrane integrationLonger expression timeCodon optimization; inducible promoters
Insect cellsBetter folding of complex proteinsHigher cost, specialized equipmentBaculovirus optimization; sequential infections
Cell-free systemsAvoids toxicity issuesLower yield, expensiveSupplementation with lipids/detergents

For initial studies, E. coli systems with N-terminal fusion tags (MBP or SUMO) often improve solubility. If membrane integration is critical for functional studies, consider using detergent-solubilized microsomal preparations or proteoliposomes for reconstitution .

How can I optimize PCR amplification and cloning of the ndhC gene from P. occidentalis chloroplast DNA?

Amplification of chloroplast genes requires careful primer design and extraction methods:

  • Chloroplast DNA isolation: Use differential centrifugation methods to enrich for chloroplasts before DNA extraction.

  • Primer design: Target the conserved regions flanking ndhC based on aligned sequences from related species. Include appropriate restriction sites for subsequent cloning.

  • PCR conditions: Initial denaturation at 94°C for 2 min, followed by 35 cycles of denaturation (94°C, 40 sec), annealing (50-55°C, 45 sec), and extension (72°C, 1 min), with final extension at 72°C for 8 min .

  • Verification methods: Sequence the amplified product to confirm identity before proceeding with cloning.

  • Cloning strategy: Consider using a Gateway or TOPO cloning system for initial capture, followed by subcloning into expression vectors appropriate for your chosen expression system.

For challenging templates, addition of PCR enhancers (DMSO, betaine) or specialized polymerases designed for GC-rich templates may improve amplification success.

What purification methods are most suitable for recombinant ndhC protein?

Purification of membrane-associated proteins like ndhC requires specialized approaches:

  • Solubilization: Screen detergents (DDM, LDAO, FC-12) for optimal solubilization while maintaining protein function. Typically start with 1% detergent at 4°C.

  • Affinity chromatography: His-tag purification using Ni-NTA resin is effective, but wash buffers should contain detergent at concentrations above the critical micelle concentration.

  • Size exclusion chromatography: Essential for separating monomeric protein from aggregates and detergent micelles.

  • Functional assessment: Verify protein activity at each purification step to ensure native conformation is maintained.

For structural studies, consider purification in nanodiscs or amphipols, which provide a more native-like environment than detergent micelles and improve stability for crystallization or cryo-EM analysis.

How can I assess the structural integrity and folding of purified recombinant ndhC?

Multiple complementary techniques should be employed:

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure content and thermal stability.

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence can indicate conformational state.

  • Limited proteolysis: Properly folded proteins often show distinct protease-resistant domains.

  • Dynamic light scattering: Assesses protein homogeneity and confirms absence of aggregation.

  • Thermal shift assays: Measures protein stability under various buffer conditions.

For membrane proteins like ndhC, reconstitution into liposomes before analysis can provide a more native-like environment for structural assessment .

What methods can be used to study electron transfer activity of recombinant ndhC?

Functional characterization of ndhC should address its role in electron transfer:

  • Spectrophotometric assays: Monitor quinone reduction using absorbance changes at specific wavelengths.

  • Oxygen consumption measurements: Using clark-type electrodes to assess electron transport rates.

  • Reconstitution studies: Incorporating purified protein into liposomes with other components of the electron transport chain.

  • EPR spectroscopy: For identifying and characterizing involved redox centers.

  • Stopped-flow kinetics: To determine rate constants for specific electron transfer steps.

When designing activity assays, consider the potential need for other subunits of the NAD(P)H dehydrogenase complex, as ndhC alone may not display full enzymatic function. Similar to studies on human NQO1, a substituted enzyme mechanism involving tightly bound cofactors is likely involved in catalysis .

How can site-directed mutagenesis be used to identify critical residues in ndhC function?

A systematic mutagenesis approach can reveal structure-function relationships:

  • Identify conserved residues through multiple sequence alignment of ndhC across plant species.

  • Target residues in predicted functional domains (cofactor binding, subunit interaction, membrane insertion).

  • Create single amino acid substitutions using PCR-based mutagenesis techniques.

  • Express and purify mutant proteins using identical conditions to wild-type.

  • Compare kinetic parameters and stability of mutants to wild-type protein.

Pay particular attention to charged residues in transmembrane regions, which often play critical roles in proton translocation or cofactor binding. Investigate the effects of mutations analogous to the p.P187S polymorphism studied in human NQO1, which affects cofactor binding and protein stability through long-range conformational effects .

How does P. occidentalis ndhC compare to orthologous genes in other plant species?

Comparative analysis reveals evolutionary patterns and functionally important regions:

  • Sequence conservation: Multiple sequence alignment shows highly conserved regions corresponding to functional domains and more variable regions that may reflect species-specific adaptations.

  • Selective pressure analysis: Calculate dN/dS ratios to identify regions under purifying or positive selection.

  • Structural modeling: Homology modeling based on related proteins can predict the structural consequences of sequence differences.

Recent phylogenetic studies indicate that chloroplast genes like ndhC can exhibit conflicts in gene trees, which may result from insufficient phylogenetic signal or, more interestingly, from biological phenomena like heteroplasmic recombination .

How can recombinant ndhC be used to study chloroplast evolution?

Recombinant protein studies provide unique evolutionary insights:

  • Functional complementation: Express P. occidentalis ndhC in mutant plants lacking functional ndhC to assess functional conservation.

  • Biochemical comparisons: Compare kinetic properties of ndhC from different species to identify functional shifts.

  • Protein-protein interaction studies: Examine cross-species compatibility of ndhC with other components of the NAD(P)H dehydrogenase complex.

  • Ancestral sequence reconstruction: Express computationally predicted ancestral ndhC sequences to study functional evolution.

These approaches can help address fundamental questions about the evolution of photosynthetic machinery and adaptation to different ecological niches .

What approaches help resolve gene tree conflicts involving ndhC in phylogenomic analyses?

Gene tree conflicts are common in plastome-inferred phylogenies and can be addressed through:

  • Model selection: Test multiple evolutionary models to find the best fit for ndhC sequences.

  • Codon-based analyses: Partition data by codon position to account for different evolutionary rates.

  • Translation-based approaches: Analyze amino acid sequences to reduce saturation effects.

  • Hypothesis testing: Use approximately unbiased (AU) tests to statistically compare alternative tree topologies.

Recent research suggests that longer chloroplast genes generally provide better phylogenetic resolution. While ndhC is not among the longest chloroplast genes, combining it with data from high-performing genes like rpoC2 can improve phylogenetic inference .

How can recombinant P. occidentalis ndhC contribute to studies of photosynthetic efficiency?

Recombinant ndhC enables mechanistic studies with potential applications:

When studying photosynthetic efficiency, consider both in vitro biochemical assays and in vivo complementation studies in model plant systems with disrupted endogenous ndhC .

What experimental approaches can address the role of heteroplasmic recombination in ndhC evolution?

Heteroplasmic recombination (recombination between different plastome variants) has been documented in angiosperms and may affect ndhC evolution:

  • Deep sequencing: Use high-throughput sequencing to detect low-frequency plastome variants.

  • Haplotype phasing: Computational methods to reconstruct recombinant haplotypes.

  • Experimental crosses: Create heteroplasmic lines by crossing plants with known plastome differences.

  • Single-molecule sequencing: Technologies like Oxford Nanopore can sequence entire plastomes without amplification bias.

  • Recombination detection algorithms: Software tools to identify breakpoints and patterns of recombination.

Recent studies have documented heteroplasmic recombination in several angiosperm species, creating opportunities for recombination that could result in gene tree conflicts in plastome-inferred phylogenies .

How can protein dynamics studies enhance our understanding of ndhC function?

Protein dynamics play crucial roles in enzyme function and can be studied through:

  • Molecular dynamics simulations: Computational approach to model protein motion over time.

  • Hydrogen-deuterium exchange mass spectrometry: Experimental approach to measure protein flexibility.

  • NMR relaxation experiments: Provides atomistic details of protein motion in solution.

  • Temperature-dependent kinetic studies: Reveals the relationship between protein dynamics and catalytic function.

Studies of human NQO1 have shown that protein dynamics significantly impact function, with mutations affecting not just local structure but also causing long-range effects through allosteric networks. The p.P187S polymorphism in human NQO1, for example, affects the FAD binding site through dynamic perturbations that propagate through the protein structure . Similar dynamics studies could reveal important functional aspects of plant ndhC.

How can I overcome expression problems with recombinant ndhC protein?

Membrane proteins like ndhC often present expression challenges:

  • Toxicity issues: If protein expression is toxic to host cells, use tightly controlled inducible systems and lower induction temperatures.

  • Protein aggregation: Try fusion partners known to enhance solubility (MBP, SUMO, TrxA) or express as fragments covering specific domains.

  • Codon optimization: Adjust codons to match host organism preferences, particularly for rare codons.

  • Expression scale: Optimize protein expression at small scale before scaling up production.

  • Extraction conditions: Screen different detergents and buffer conditions for optimal solubilization.

Consider using a cell-free expression system if cellular toxicity cannot be overcome. These systems allow direct incorporation into liposomes or nanodiscs during synthesis .

What strategies help resolve contamination issues in chloroplast DNA isolation?

Obtaining pure chloroplast DNA is critical for accurate ndhC amplification:

  • Differential centrifugation: Optimize speed and duration to separate chloroplasts from other cellular components.

  • DNase treatment: Treat intact chloroplasts with DNase to digest contaminating nuclear DNA before lysis.

  • Gradient purification: Use sucrose or Percoll gradients for higher purity chloroplast isolation.

  • Young tissue selection: Use young leaves grown under moderate light conditions to maximize chloroplast quality.

  • PCR specificity: Design primers specific to chloroplast ndhC sequences to avoid amplification of nuclear pseudogenes.

The method used for Hyoscyamus niger chloroplast genome sequencing demonstrates the importance of read depth analysis in distinguishing chloroplast sequences (read depth >150) from nuclear and mitochondrial contigs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.