Recombinant Platanus occidentalis Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production of CP47

Recombinant CP47 is typically expressed in E. coli or mammalian cell systems for structural and functional studies. While P. occidentalis-specific protocols are unreported, methodologies from related species (e.g., Lactuca sativa, Populus deltoides) provide a template :

Table 1: Recombinant CP47 Production Parameters (Generalized)

ParameterSpecificationSource
Expression SystemE. coli (N-terminal His tag)
Protein LengthFull-length (1–508 aa)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder at -20°C/-80°C
ReconstitutionTris/PBS buffer with 6% trehalose

Notes:

  • Tagging: His tags enable affinity chromatography purification .

  • Stability: Glycerol (5–50%) is added to prevent aggregation during storage .

Role in PSII Assembly

  • CP47 forms a preassembly module (CP47m) with PsbH, PsbL, and PsbT before integrating into the PSII core .

  • In Synechocystis sp., Pam68 facilitates chlorophyll insertion into CP47 during membrane integration .

Biotechnological Applications

Recombinant CP47 is pivotal for:

  • Photosynthesis Research: Elucidating PSII assembly intermediates and photodamage repair mechanisms .

  • Bioengineering: Optimizing light-harvesting efficiency in synthetic photosynthetic systems .

Limitations and Future Directions

  • Species-Specific Data: No direct studies on P. occidentalis psbB exist; inferences rely on homologs (e.g., Populus deltoides, UniProt O03061) .

  • Functional Validation: In vitro reconstitution assays are needed to confirm chlorophyll-binding kinetics and Mn cluster interactions in recombinant P. occidentalis CP47.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipment, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Platanus occidentalis (Sycamore) (American plane tree)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGTGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function
CP47 (Photosystem II CP47 chlorophyll apoprotein, encoded by the *psbB* gene) is a key component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions within PSII. PSII, a light-driven water:plastoquinone oxidoreductase, utilizes light energy to extract electrons from water, generating oxygen and a proton gradient, which is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.