Recombinant Platanus occidentalis Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Primary Structure

The D1 protein (psbA) is a transmembrane protein with a molecular weight of ~32 kDa. The recombinant Platanus occidentalis psbA spans 344 amino acids, with a His-tag for purification. Key structural features include:

FeatureDescriptionSource
Amino Acid SequenceFull-length sequence (1–344 aa) including motifs for cofactor binding and membrane integration.
His-TagN-terminal His-tag for affinity chromatography.
Functional DomainsIncludes the QB-binding pocket, DE loop (interacts with PSII assembly factors), and Mn4CaO5 cluster-binding regions.

The amino acid sequence aligns with conserved residues critical for PSII function, such as the glutamic acid (E) and aspartic acid (D) loops involved in water oxidation .

Role in PSII Activity

The D1 protein forms the core of PSII’s reaction center, mediating:

  1. Electron Transfer: Transfers electrons from P680 to pheophytin and plastoquinone (QA and QB) .

  2. Water Oxidation: Coordinates the Mn4CaO5 cluster for water splitting, producing O2 and protons .

  3. Herbicide Binding: The QB pocket is a target site for herbicides like DCMU .

Interactions with Auxiliary Proteins

ProteinRoleSource
PsbQStabilizes the oxygen-evolving complex (OEC) and regulates Cl−/Ca²⁺ binding.
HCF244Activates psbA translation in both light and dark conditions.
RBD1Enhances psbA translation in light by antagonizing repressive factors.

Expression and Tagging

  • Host: Escherichia coli .

  • Tag: N-terminal His-tag for nickel-affinity chromatography .

  • Form: Lyophilized powder in Tris/PBS buffer with 6% trehalose .

Quality Control

ParameterSpecificationSource
Purity>90% (SDS-PAGE analyzed)
Storage-20°C/-80°C (avoid repeated freeze-thaw cycles)

Experimental Uses

ApplicationPurposeSource
ELISAQuantitative detection of psbA in PSII preparations.
Structural StudiesCryo-EM or X-ray crystallography to study D1 interactions in PSII cores.
Functional AssaysHerbicide binding kinetics or electron transfer measurements.

Key Findings

  • Stability: PsbQ-deficient mutants show unstable OEC and prolonged S2-state lifetime, emphasizing psbA-PsbQ interactions .

  • Translation Regulation: HCF244 and RBD1 modulate psbA expression in response to light-induced D1 photodamage .

Comparative Analysis of psbA Across Organisms

OrganismpsbA FeaturesSource
Platanus occidentalisSingle psbA gene; His-tagged recombinant protein for research.
CyanobacteriaMultiple psbA genes (e.g., psbA1, psbA2, psbA3) for light acclimation.
Prorocentrum micansRecombinant psbA (343 aa) with similar QB-binding motifs.

Challenges and Future Directions

  • Limited Structural Data: No high-resolution 3D structure of Platanus occidentalis psbA is available.

  • Functional Studies: Further work is needed to resolve psbA interactions with assembly factors like HCF244 in higher plants.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs as much as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Platanus occidentalis (Sycamore) (American plane tree)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H2O, generating O2 and a proton gradient, which is subsequently utilized for ATP formation. It comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the psbA protein function within the photosynthetic machinery?

The psbA protein serves as a critical component of the reaction center in Photosystem II, where it forms a heterodimer with the D2 protein. This complex contains binding sites for essential cofactors involved in the primary photochemical reactions of photosynthesis. The primary function of psbA is to facilitate electron transport from water to plastoquinone .

The process begins when light energy is captured by chlorophyll molecules and transferred to the reaction center. This excitation energy induces charge separation at P680 (the primary electron donor), leading to the sequential transfer of electrons through a series of redox-active cofactors bound to the psbA protein. This electron transport ultimately results in the reduction of plastoquinone to plastoquinol at the QB binding site, which is located within the psbA protein structure .

A distinctive feature of the psbA protein is its involvement in the water-splitting reaction of photosynthesis. The protein helps coordinate the Mn4CaO5 cluster (oxygen-evolving complex) that catalyzes the oxidation of water to molecular oxygen, releasing protons and electrons in the process. This reaction is fundamental to oxygenic photosynthesis and represents one of the most significant biological processes on Earth .

What are the optimal methods for quantifying recombinant psbA protein expression in experimental systems?

Quantification of recombinant psbA protein expression requires specialized techniques due to the protein's membrane-bound nature and relatively low abundance. Based on recent advancements, the following methodological approach is recommended:

Reverse Phase-LC-Electrospray Mass Ionization-MS/MS (RP-LC-ESI-MS/MS) Analysis:
This technique represents the gold standard for psbA protein quantification, particularly when dealing with multiple isoforms with high sequence similarity. The method involves:

  • Protein extraction using detergent-based buffer systems optimized for membrane proteins

  • Proteolytic digestion to generate peptide fragments

  • LC separation of peptides

  • MS/MS detection and quantification based on unique peptide signatures

This approach offers superior sensitivity and specificity compared to traditional immunoblotting techniques, allowing researchers to distinguish between highly similar psbA protein variants .

Comparison of Quantification Methods for psbA Protein:

MethodSensitivitySpecificityAbility to Distinguish IsoformsTechnical Complexity
RP-LC-ESI-MS/MSVery HighVery HighExcellentHigh
Western BlottingModerateModerateLimitedModerate
ELISAHighModerate-HighLimitedModerate
Spectroscopic MethodsLowLowPoorLow

When implementing these methods, researchers should be aware that psbA protein expression can vary significantly in response to environmental conditions, particularly light intensity. Studies have shown that high light exposure can trigger increased turnover of psbA protein, necessitating careful experimental design and standardization of light conditions during quantification experiments .

How can researchers effectively design experiments to assess psbA protein turnover rates under varying environmental conditions?

Designing experiments to assess psbA protein turnover requires careful consideration of multiple variables due to the dynamic nature of this protein in response to environmental stressors. An effective experimental approach should incorporate:

Pulse-Chase Labeling Protocol:

  • Introduce isotopically labeled amino acids (e.g., 35S-methionine) to growing plant tissue for a defined period (pulse phase)

  • Transfer to media containing unlabeled amino acids (chase phase)

  • Collect samples at predetermined time points

  • Extract and analyze psbA protein to determine the rate of labeled protein degradation

Environmental Variable Control and Manipulation:
When studying environmental effects on psbA turnover, researchers should systematically control:

  • Light intensity (photosynthetically active radiation)

  • Light quality (wavelength composition)

  • Temperature fluctuations

  • Water availability

  • Nutrient status

Quantification Methods for Turnover Assessment:

  • Western blotting with anti-D1 antibodies combined with densitometry

  • RP-LC-ESI-MS/MS analysis of peptide fragments

  • Calculation of half-life (t½) based on exponential decay models

Studies with Platanus species have demonstrated that psbA protein turnover rates increase significantly under high light stress conditions, with turnover rates accelerating by 2-4 times compared to moderate light conditions . This rapid turnover represents a crucial adaptation mechanism that allows the photosynthetic apparatus to recover from photodamage by replacing damaged D1 proteins with newly synthesized copies.

How does the psbA gene structure in Platanus occidentalis compare with other plant species, and what evolutionary insights can be derived?

The psbA gene in Platanus occidentalis exhibits several distinctive characteristics when compared to other plant species, providing valuable insights into photosynthetic adaptation and evolution.

In Platanus occidentalis, the psbA gene is located on the plastid genome and encodes the full-length D1 protein. Unlike cyanobacteria, which typically possess multiple psbA gene copies (often three, as seen in Thermosynechococcus elongatus), most higher plants including P. occidentalis contain a single psbA gene copy . This evolutionary difference suggests specialized adaptation strategies between prokaryotic and eukaryotic photosynthetic organisms.

Comparative Analysis of psbA Gene Structure Across Species:

SpeciesNumber of psbA GenesGenomic LocationNotable Adaptations
Platanus occidentalis1Plastid genomeConserved structure typical of angiosperms
Thermosynechococcus elongatus3 (psbA1, psbA2, psbA3)Bacterial genomeDifferential expression under stress conditions
Platanus orientalis1Plastid genomeAdaptation to drought conditions
Typical angiosperm1Plastid genomeHigh sequence conservation

Comparative studies between Platanus occidentalis and its close relative Platanus orientalis have revealed that despite high sequence similarity in their psbA genes, there are significant differences in their expression patterns and regulation, particularly in response to drought stress. These adaptations appear to reflect the species' native habitat conditions, with P. orientalis (particularly the Italian ecotype) demonstrating enhanced drought tolerance mechanisms, including more efficient photosynthetic energy utilization under water stress .

What functional differences exist between the psbA protein variants in different photosynthetic organisms?

Functional differences between psbA protein variants across photosynthetic organisms represent crucial adaptations to diverse environmental niches. These variations affect photosynthetic efficiency, stress tolerance, and energy distribution within Photosystem II.

In cyanobacteria such as Thermosynechococcus elongatus, which possess multiple psbA gene copies (psbA1, psbA2, psbA3), each variant produces a slightly different D1 protein with specialized functions. Research has demonstrated that:

  • PsbA3 becomes predominant under high light conditions (approximately 70% of total PsbA content)

  • PsbA1 functions optimally under normal light conditions

  • PsbA2 appears to be expressed at negligible levels under most tested conditions

These different D1 protein variants exhibit distinct functional properties:

Redox Properties and Energy Transfer Characteristics:
Thermoluminescence and delayed fluorescence measurements have revealed that PsbA3-containing PSII complexes demonstrate a shift in free energy between redox pairs compared to PsbA1-containing complexes. This shift is attributed to a more positive redox potential of pheophytin in PsbA3, which provides enhanced protection against photoinhibition by increasing the probability of harmless dissipation of excess energy .

In contrast, higher plants like Platanus occidentalis possess a single psbA gene copy, requiring different adaptation strategies. Instead of expressing alternative protein variants, these plants modulate psbA expression levels and protein turnover rates in response to environmental conditions .

Comparative studies between Platanus species have shown that ecotypes from different habitats develop distinct physiological adaptations. For example, Platanus orientalis ecotypes from drier, warmer environments (Italian ecotype) demonstrate:

  • Higher constitutive isoprene emission

  • More active stomatal behavior

  • Modified chloroplast ultrastructure

  • More efficient use of absorbed light energy for photochemistry

These adaptations ultimately confer greater drought tolerance and photosynthetic efficiency under stress conditions compared to ecotypes from more optimal growth conditions (Bulgarian ecotype) .

How can recombinant psbA protein be utilized in photosynthesis research to address questions of environmental adaptation?

Recombinant psbA protein represents a powerful tool for investigating photosynthetic adaptation to environmental challenges. Advanced research applications include:

Site-Directed Mutagenesis Studies:
Recombinant psbA can be modified through targeted amino acid substitutions to investigate the functional significance of specific residues. This approach has revealed critical regions involved in:

  • Binding of cofactors essential for electron transport

  • Interaction with other PSII subunits

  • Susceptibility to photodamage under high light conditions

  • Herbicide resistance mechanisms

By comparing the performance of mutated recombinant proteins with wild-type variants, researchers can identify precise molecular mechanisms underlying photosynthetic adaptation .

Reconstitution Experiments:
Purified recombinant psbA protein can be incorporated into artificial membrane systems or psbA-depleted thylakoid preparations to assess functional properties. This approach allows researchers to:

  • Evaluate the sufficiency of specific psbA variants to restore photosynthetic activity

  • Measure electron transport rates under controlled conditions

  • Assess redox properties using spectroscopic techniques

  • Investigate interactions with other photosynthetic components

Comparative Ecotype Studies:
Recombinant psbA proteins from different Platanus ecotypes can be compared to understand molecular adaptations to specific environmental conditions. For example, research with Platanus orientalis has demonstrated that:

  • Ecotypes from drier, warmer environments (Italian ecotype) show distinct adaptations

  • These adaptations include modified chloroplast ultrastructure and more effective light energy utilization

  • Under drought stress, the Italian ecotype showed less damage and better membrane stability

These findings suggest that psbA protein modifications play a significant role in habitat-specific adaptations, offering insights into how plants might adapt to climate change .

What methodological approaches can be used to investigate the relationship between psbA protein structure and photoinhibition resistance?

Investigating the relationship between psbA protein structure and photoinhibition resistance requires sophisticated methodological approaches that integrate structural analysis with functional characterization. The following methods represent current best practices:

Structural Analysis Techniques:

  • X-ray Crystallography: Provides high-resolution structural data but requires successful crystallization of membrane proteins (challenging for psbA)

  • Cryo-Electron Microscopy: Offers near-atomic resolution of protein complexes in their native state without crystallization

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: Provides dynamic structural information in solution, particularly useful for specific domains

Functional Characterization Methods:

  • Chlorophyll Fluorescence Analysis:

    • Pulse-Amplitude Modulation (PAM) fluorometry to measure photochemical and non-photochemical quenching

    • Fast fluorescence induction kinetics to assess PSII electron transport efficiency

    • Measurements under varying light conditions to quantify photoinhibition rates

  • Thermoluminescence and Delayed Fluorescence:
    These techniques reveal shifts in redox potential between electron transport components. Studies with Thermosynechococcus elongatus have shown that PsbA3-containing PSII complexes exhibit a shift in the redox potential of pheophytin toward more positive values compared to PsbA1, correlating with enhanced photoinhibition resistance .

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:
    Provides detailed information about the redox states of electron transport components and can detect subtle changes in electron transfer kinetics resulting from structural variations.

Integrated Approach for Structure-Function Analysis:

A comprehensive investigation should integrate these methods along with site-directed mutagenesis of key amino acid residues. This approach has revealed that specific regions of the psbA protein, particularly those involved in binding the Mn4CaO5 cluster and quinone acceptors, are critical determinants of photoinhibition resistance.

Research findings indicate that even subtle amino acid differences between psbA variants can significantly alter photoinhibition susceptibility. For example, in cyanobacterial systems, PsbA3 complexes provide better protection against photoinhibition due to modified energy dissipation pathways, despite high sequence similarity to other variants .

What are the main challenges in purifying active recombinant psbA protein, and how can they be overcome?

Purification of active recombinant psbA protein presents several significant challenges due to its intrinsic properties as an integral membrane protein and its functional requirements. These challenges and their potential solutions include:

Challenge 1: Membrane Protein Solubilization
The hydrophobic nature of psbA protein makes it inherently difficult to maintain in solution outside of a lipid environment.

Solution:

  • Use of specialized detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin that preserve protein structure

  • Employing amphipathic polymers like styrene-maleic acid lipid particles (SMALPs) to extract membrane proteins with their native lipid environment

  • Implementation of optimized buffer systems containing glycerol (50%) and stabilizing agents as described in the product specifications

Challenge 2: Maintaining Cofactor Association
The psbA protein requires multiple cofactors for proper function, including chlorophylls, pheophytins, quinones, and metal ions forming the Mn4CaO5 cluster.

Solution:

  • Co-expression of accessory proteins needed for cofactor insertion

  • Supplementation of purification buffers with essential cofactors

  • Two-stage purification protocol that preserves protein-cofactor interactions

Challenge 3: Protein Instability and Aggregation
The psbA protein is naturally prone to rapid turnover and can aggregate when removed from its native environment.

Solution:

  • Storage at -20°C or -80°C for extended preservation

  • Avoidance of repeated freeze-thaw cycles

  • Maintenance of working aliquots at 4°C for no more than one week

  • Use of stabilizing additives such as glycerol, sucrose, or specific lipids

Optimized Purification Protocol:
Based on current research, a recommended workflow for purifying active recombinant psbA protein includes:

  • Expression in a suitable host system (e.g., modified E. coli strains with chloroplast-like expression machinery)

  • Gentle cell disruption to preserve protein integrity

  • Membrane fraction isolation via differential centrifugation

  • Solubilization with appropriate detergent at optimal concentration

  • Affinity chromatography utilizing engineered tags (determined during production process)

  • Size-exclusion chromatography for final purification

  • Immediate stabilization in appropriate buffer containing 50% glycerol

How can researchers effectively design experiments to correlate psbA gene expression with protein accumulation under stress conditions?

Designing experiments to correlate psbA gene expression with protein accumulation under stress conditions requires careful consideration of multiple factors and integrated methodological approaches. An effective experimental design should incorporate:

Temporal Resolution:
The dynamic nature of psbA expression and protein turnover necessitates high temporal resolution sampling. Research has demonstrated that significant changes can occur within hours or even minutes of stress application .

Recommended Sampling Timeline:

  • Baseline measurements before stress application

  • Early response (15 minutes, 30 minutes, 1 hour post-stress)

  • Intermediate response (3 hours, 6 hours, 12 hours post-stress)

  • Long-term response (24 hours, 48 hours, 72 hours post-stress)

  • Recovery phase (if applicable)

Gene Expression Analysis:

  • Real-time quantitative PCR (RT-qPCR):

    • Requires careful primer design specific to psbA sequences

    • Necessitates appropriate reference genes for normalization

    • Enables quantification of transcript abundance

  • RNA-Seq:

    • Provides comprehensive transcriptome analysis

    • Allows identification of co-regulated genes

    • Enables discovery of novel transcripts or splice variants

Protein Quantification:

  • RP-LC-ESI-MS/MS Analysis:
    This technique has been successfully established for PsbA protein quantification, enabling accurate comparison of transcript and protein levels .

  • Pulse-Chase Experiments:

    • Incorporate isotopically labeled amino acids to track newly synthesized proteins

    • Enable distinction between de novo synthesis and protein degradation

    • Allow calculation of protein half-life under different conditions

Integrated Analysis Framework:
To effectively correlate gene expression with protein accumulation, researchers should implement:

  • Statistical Analysis:

    • Time series analysis to identify patterns and relationships

    • Correlation coefficients between transcript and protein levels

    • Multivariate analysis to account for multiple interacting factors

  • Mathematical Modeling:

    • Development of predictive models incorporating synthesis and degradation rates

    • Inclusion of time delays between transcription and translation

    • Incorporation of protein turnover kinetics

What emerging technologies might advance our understanding of psbA protein function in Platanus species?

Several emerging technologies hold promise for advancing our understanding of psbA protein function in Platanus species, potentially opening new research frontiers:

CRISPR-Cas9 Technology for Plastome Editing:
Recent advancements in chloroplast genome editing using CRISPR-Cas9 systems could enable precise modification of the psbA gene in Platanus species. This approach would allow:

  • Introduction of specific mutations to investigate structure-function relationships

  • Creation of tagged versions of psbA for in vivo tracking

  • Generation of knockout or knockdown lines to assess physiological impacts

  • Development of plants expressing alternative psbA variants for comparative studies

Advanced Cryo-Electron Microscopy (Cryo-EM):
Recent breakthroughs in cryo-EM technology now enable near-atomic resolution visualization of membrane protein complexes in their native state. Application to Platanus psbA-containing complexes could:

  • Reveal species-specific structural adaptations

  • Identify subtle conformational changes under different environmental conditions

  • Elucidate interaction interfaces with other photosynthetic components

  • Capture dynamic structural changes during the photocycle

Single-Molecule Fluorescence Techniques:
These approaches allow observation of individual protein molecules, providing insights into:

  • Real-time conformational dynamics of psbA protein

  • Heterogeneity in protein behavior within populations

  • Transient interactions with other photosynthetic components

  • Energy transfer pathways at the molecular level

Multiscale Computational Modeling:
Integration of quantum mechanical calculations, molecular dynamics simulations, and systems biology approaches could provide unprecedented insights into:

  • Electronic structure and electron transfer kinetics within psbA

  • Conformational dynamics and structural adaptations to stress

  • Species-specific functional variations at the atomic level

  • Prediction of how sequence variations might affect function and stress tolerance

These technologies could help address fundamental questions about how Platanus species have adapted their photosynthetic machinery to specific environmental niches, potentially informing conservation strategies for endangered Platanus species and contributing to the development of more resilient crop varieties in the face of climate change .

How might research on Platanus occidentalis psbA protein contribute to addressing challenges in photosynthesis engineering and crop improvement?

Research on Platanus occidentalis psbA protein has significant potential to contribute to photosynthesis engineering and crop improvement strategies, particularly in addressing climate change-related challenges:

Enhanced Photoinhibition Resistance:
Comparative studies between different Platanus ecotypes have revealed adaptations in photosynthetic machinery that confer enhanced stress tolerance . Understanding the molecular basis of these adaptations could inform the development of crops with:

  • Improved photosynthetic efficiency under fluctuating light conditions

  • Enhanced recovery from photoinhibition

  • Reduced yield losses during heat and drought stress events

  • More efficient light energy utilization across diverse environments

Insights from Evolutionary Adaptations:
Platanus occidentalis represents an interesting model system due to its evolutionary history and ecological adaptations. Research findings suggest that:

  • Species at the edge of their natural habitat (like Italian ecotypes of Platanus orientalis) have developed specialized photosynthetic adaptations to more stressful environments

  • These adaptations include modifications in psbA protein function and photosystem structure

  • Such naturally evolved solutions could inform targeted engineering approaches

Potential Applications in Crop Improvement:

  • Transfer of Beneficial Traits:
    Identification of specific amino acid substitutions or regulatory elements that enhance psbA protein function under stress could guide precision engineering of crop species.

  • Biomarker Development:
    Insights from psbA protein dynamics could lead to the development of molecular markers for screening germplasm for photosynthetic efficiency and stress tolerance.

  • Predictive Modeling:
    Understanding how psbA protein variants perform under different conditions could inform computational models predicting crop performance under future climate scenarios.

  • Novel Screening Methods:
    Discoveries about psbA protein function could lead to innovative phenotyping approaches for rapid assessment of photosynthetic efficiency in breeding programs.

As climate change intensifies, crops will face increasing challenges from drought, heat, and irregular precipitation patterns. The naturally evolved adaptations in Platanus species' photosynthetic machinery, particularly in the critical psbA protein, represent valuable blueprints for engineering more resilient crop varieties. By understanding how these long-lived trees have optimized their photosynthetic apparatus for survival under variable conditions, researchers can potentially develop targeted strategies to enhance crop productivity and stability in the face of environmental change .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.