Recombinant Platymonas subcordiformis NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Description

Introduction to Platymonas subcordiformis NADH-ubiquinone oxidoreductase chain 3

Platymonas subcordiformis, also known as Tetraselmis subcordiformis or Carteria subcordiformis, is a marine green alga that has garnered significant interest in biochemical research . Within this organism, the NADH-ubiquinone oxidoreductase chain 3 (ND3) represents a crucial component of the mitochondrial respiratory complex I, which catalyzes the transfer of electrons from NADH to ubiquinone in the electron transport chain. This process is fundamental to cellular energy production.

The ND3 protein is encoded by the mitochondrial genome, specifically by the gene designated as ND3 or NAD3 . As a mitochondrially encoded protein, it plays a vital role in the structure and function of complex I, which is the first and largest enzymatic complex in the respiratory chain. The recombinant form of this protein has been developed to facilitate various research applications, including structural studies, functional analyses, and immunological investigations.

Taxonomic classification and nomenclature

The protein is derived from Platymonas subcordiformis, a species that has undergone several taxonomic reclassifications. Currently, it is often referred to as Tetraselmis subcordiformis in scientific literature, though the name Platymonas subcordiformis remains widely used in biochemical research and product listings . This unicellular green alga is classified under the following taxonomic hierarchy:

Taxonomic LevelClassification
KingdomPlantae
DivisionChlorophyta
ClassChlorodendrophyceae
OrderChlorodendrales
FamilyChlorodendraceae
GenusTetraselmis (formerly Platymonas)
SpeciesT. subcordiformis (P. subcordiformis)

Biological significance

The ND3 protein functions as an integral membrane subunit of NADH-ubiquinone oxidoreductase (Complex I), which catalyzes the transfer of electrons from NADH to ubiquinone (Coenzyme Q10) with a concomitant translocation of protons across the inner mitochondrial membrane . This proton pumping activity contributes to the electrochemical gradient that drives ATP synthesis, making ND3 essential for cellular energy metabolism.

Protein sequence and structure

The full-length Platymonas subcordiformis ND3 protein consists of 117 amino acids with the following sequence:
MIEYLAVLIYFLFSLALASLIIFLSFIFAPQKPDPEKISAYECGFDPFDDARGKFDIRFYLVAILFIIFDLEVTFLFPWAVTLGKIGFFGFWTMMAFLIILTIGFIYEWKKGALEWE

This sequence forms a membrane protein with multiple hydrophobic regions that anchor it within the mitochondrial inner membrane. Structural predictions suggest that the protein contains two to three transmembrane helices connected by hydrophilic loops. These structural elements are critical for the protein's function in the respiratory chain complex.

Role in complex I assembly and function

The ND3 protein constitutes a critical structural component of respiratory complex I. Research on bovine complex I has identified the ND3 subunit as being involved in the active/deactive enzyme transition of this respiratory complex . This transition represents a conformational change that affects the activity of the entire complex.

The specific cysteine residue at position 39 in bovine ND3 (which may have a counterpart in Platymonas subcordiformis ND3) is particularly significant, as it becomes accessible for chemical modification only in the deactive form of complex I . This suggests that the region around this residue undergoes conformational changes during the catalytic cycle of the enzyme.

Evolutionary conservation

The ND3 protein sequence is generally well-conserved across species, though with some notable variations. For instance, while a highly conserved cysteine residue is present in mammalian ND3 proteins, it is replaced by serine in bacterial homologs such as those from Escherichia coli and Thermus thermophilus . The conservation pattern suggests functional importance for specific regions of the protein while allowing for taxon-specific adaptations.

Production and Characterization of Recombinant Platymonas subcordiformis ND3

The production of recombinant Platymonas subcordiformis ND3 involves specific methodologies to ensure proper expression, folding, and functionality of this membrane protein.

Expression and purification methods

The recombinant protein is typically expressed in E. coli expression systems, which provide a cost-effective and scalable platform for protein production . The full-length coding sequence (spanning amino acids 1-117) is cloned into an appropriate expression vector that incorporates an N-terminal histidine tag for purification purposes.

After expression, the protein is purified using immobilized metal affinity chromatography (IMAC), taking advantage of the histidine tag's affinity for divalent metal ions such as nickel or cobalt. Following purification, the protein undergoes quality control assessments, including SDS-PAGE analysis to confirm purity exceeding 90% .

Research Applications of Recombinant Platymonas subcordiformis ND3

The recombinant form of Platymonas subcordiformis ND3 offers various potential applications in biochemical and biomedical research, though specific applications are not explicitly outlined in the search results.

Antibody production and immunological applications

The purified recombinant protein can serve as an antigen for the production of specific antibodies against Platymonas subcordiformis ND3. Such antibodies can be valuable for:

  1. Immunodetection of ND3 in algal samples

  2. Localization studies using immunofluorescence or immunoelectron microscopy

  3. Pull-down assays to identify interacting proteins

  4. Quantification of ND3 expression levels under different physiological conditions

Enzyme-linked immunosorbent assay (ELISA)

One specific application mentioned in the search results is the use of recombinant Platymonas subcordiformis ND3 in ELISA-based assays . These assays can provide sensitive and specific detection of antibodies against this protein or quantification of the protein itself in biological samples.

Comparison with Homologous Proteins

Understanding the relationship between Platymonas subcordiformis ND3 and its homologs in other organisms can provide context for its evolutionary significance and functional conservation.

Evolutionary adaptations in algal ND3

Marine algae like Platymonas subcordiformis have evolved under distinct environmental conditions compared to terrestrial organisms, potentially leading to specific adaptations in their respiratory chain components, including ND3. These adaptations may reflect optimizations for function under the unique physiological conditions experienced by marine photosynthetic organisms, such as fluctuating light conditions, temperature variations, and ionic strength differences.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice packaging, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized formulations typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize development according to your specifications.
Synonyms
ND3; NAD3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Tetraselmis subcordiformis (Marine green alga) (Carteria subcordiformis)
Target Names
ND3
Target Protein Sequence
MIEYLAVLIYFLFSLALASLIIFLSFIFAPQKPDPEKISAYECGFDPFDDARGKFDIRFY LVAILFIIFDLEVTFLFPWAVTLGKIGFFGFWTMMAFLIILTIGFIYEWKKGALEWE
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be a crucial component of the minimal assembly required for catalysis. Complex I plays a vital role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for this enzyme is believed to be ubiquinone.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Platymonas subcordiformis and why is it used for recombinant protein expression?

Platymonas subcordiformis (now classified as Tetraselmis subcordiformis) is a unicellular marine green alga widely used in aquaculture as feed for fish, bivalve mollusks, penaeid shrimp larvae, and rotifers due to its rich nutrient profile. It contains high quantities of polysaccharides, proteins, polyunsaturated fatty acids, and vitamins . As a eukaryotic expression host, P. subcordiformis offers several advantages for recombinant protein production, including proper post-transcriptional modifications, a stable nuclear transformation system, and the potential for oral delivery of bioactive compounds through the aquaculture food chain . Its compressed cellular shape (11-16 μm in length, 7-9 μm in width, 3.5-5 μm in thickness) and established large-scale cultivation technology make it particularly suitable for biotechnological applications .

What is NADH-ubiquinone oxidoreductase and what role does ND3 play in its function?

NADH-ubiquinone oxidoreductase (Complex I) is among the largest and most complex membrane protein assemblies in the mitochondrial respiratory chain. This enzyme substantially contributes to oxidative energy conversion in eukaryotic cells, and its malfunctions are implicated in numerous hereditary and degenerative disorders . Within this complex, the ND3 subunit (NADH-ubiquinone oxidoreductase chain 3) is one of the core membrane-spanning subunits that participates in the proton-pumping machinery. Based on structural studies of mitochondrial Complex I, ND3 likely contributes to the continuous axis of basic and acidic residues that runs centrally through the membrane arm, connecting the ubiquinone reduction site to the proton-pumping units .

What transformation methods are effective for expressing recombinant proteins in Platymonas subcordiformis?

For recombinant protein expression in P. subcordiformis, particle bombardment has been demonstrated as an effective transformation method. This technique involves coating gold particles with the gene of interest and physically delivering them into algal cells . A stable nuclear transformation system has been established using the herbicide phosphinothricin (PPT, brand name Basta) as a selective agent, coupled with the Basta resistance gene (bar) as a selectable marker . Additionally, glass-bead agitation has been reported as an alternative transformation method for this microalga . Among the exogenous promoters tested, CaMV35S and SV40 promoters have shown higher transformation efficiency than the CMV promoter .

How can researchers optimize the selection process for obtaining stable transformants of P. subcordiformis expressing recombinant ND3?

Obtaining stable P. subcordiformis transformants expressing recombinant proteins requires a rigorous multi-stage screening process:

  • Initial screening in liquid medium containing phosphinothricin (PPT) to eliminate the majority of untransformed cells (culture medium will change from green to white as non-resistant cells die)

  • Secondary screening on solid agar plates containing PPT to isolate monoclonal algal strains

  • PCR detection of both the selection marker (bar gene) and the gene of interest (e.g., ND3) to identify positive transformants

  • Southern blotting analysis to confirm stable genomic integration

  • Protein expression verification through Western blotting

  • Functional assays to confirm bioactivity of the recombinant protein

It's important to note that not all colonies displaying herbicide resistance will contain the gene of interest, as demonstrated in the Reteplase expression study where only 4 out of 8 bar-positive colonies also contained the recombinant gene . Furthermore, even among colonies with confirmed gene integration, not all may express the functional protein due to potential silencing effects or improper post-translational modifications .

What are the recommended methods for purifying recombinant ND3 from transformed P. subcordiformis?

For purifying recombinant proteins from P. subcordiformis, affinity chromatography using a histidine tag system has been successfully employed. The recommended approach includes:

  • Designing the recombinant construct with a His-tag (six histidine CAC codons) after the start codon of the gene of interest

  • Cultivating transformed algal strains in 2L Erlenmeyer flasks to increase biomass

  • Extracting soluble proteins from the algal biomass

  • Purifying the recombinant protein using Ni²⁺ affinity chromatography

  • Confirming the identity and purity of isolated protein through Western blotting using appropriate antibodies

This method has achieved purification yields of 0.76-1.91‰ of total soluble protein for recombinant proteins in P. subcordiformis . When working with membrane proteins like ND3, additional optimization of detergent conditions may be necessary to maintain the protein's native conformation during purification.

What techniques can be used to verify the proper folding and functional activity of recombinant ND3?

Verifying proper folding and functional activity of recombinant membrane proteins like ND3 requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure elements

    • Limited proteolysis to probe the accessibility of cleavage sites

    • Size-exclusion chromatography to confirm proper oligomeric state

  • Functional assays:

    • NADH oxidation activity measurements using spectrophotometric methods

    • Ubiquinone reduction assays to assess electron transfer capability

    • Proton pumping activity using pH-sensitive fluorescent probes

  • Interaction studies:

    • Co-immunoprecipitation with other complex I subunits

    • Blue native PAGE to assess incorporation into the larger complex

    • Inhibitor binding studies using known Complex I inhibitors

For respiratory chain components like ND3, reconstitution into liposomes or nanodiscs may be necessary to properly evaluate function in a membrane environment that mimics their native conditions .

How does the structure-function relationship of ND3 in P. subcordiformis compare to other organisms, and what implications does this have for recombinant expression?

The structure-function relationship of ND3 must be analyzed within the context of the entire Complex I architecture. Based on studies of mitochondrial Complex I:

  • Structural considerations: ND3 contains multiple transmembrane helices that contribute to the central proton translocation pathway. The continuous axis of basic and acidic residues running through the membrane arm connects the ubiquinone reduction site to proton-pumping units . When expressing recombinant ND3, preserving these structural features is critical.

  • Functional domains: ND3 likely participates in conformational changes during the catalytic cycle that couples electron transfer to proton pumping. The "deactive" and "active" states of Complex I involve structural rearrangements at the ubiquinone reduction site that may affect ND3 .

  • Expression challenges: As a hydrophobic membrane protein with complex interactions within the respiratory chain, recombinant expression of functional ND3 presents significant challenges. The algal expression system must properly insert the protein into membranes and provide the lipid environment necessary for folding.

  • Species differences: While the core function of Complex I is conserved, species-specific variations in ND3 sequence and structure may affect its stability and interactions when expressed recombinantly. Comparing P. subcordiformis ND3 sequence with other model organisms could reveal important structural constraints.

Understanding these relationships is crucial for developing strategies to express functional recombinant ND3 that maintains its native conformation and activity.

What factors influence the expression levels of recombinant ND3 in P. subcordiformis, and how can these be optimized?

Multiple factors influence recombinant protein expression levels in P. subcordiformis:

  • Promoter selection: Previous studies have shown that CaMV35S and SV40 promoters yield higher transformation rates than the CMV promoter in P. subcordiformis . Testing endogenous stronger promoters could potentially improve expression levels.

  • Codon optimization: Adapting the ND3 gene sequence to match the codon usage preferences of P. subcordiformis may enhance translation efficiency.

  • Integration site effects: The genomic location where the transgene integrates can significantly impact expression levels due to position effects and local chromatin structure. Screening numerous transformants is essential to identify high-expressing clones.

  • Culture conditions: Optimizing growth parameters including light intensity, photoperiod, temperature, and nutrient availability can significantly affect recombinant protein yields.

  • Protein toxicity mitigation: As a membrane protein involved in energy metabolism, overexpression of ND3 might disrupt cellular homeostasis. Inducible expression systems or targeting to specific subcellular compartments might help mitigate potential toxicity.

For optimizing expression, researchers should consider screening more positive transformants and systematically testing different growth and fermentation conditions, as suggested for improving Reteplase expression in P. subcordiformis .

What are the challenges in maintaining proper post-translational modifications of recombinant ND3 in P. subcordiformis?

Ensuring proper post-translational modifications (PTMs) of recombinant ND3 involves addressing several challenges:

  • Membrane insertion: As an integral membrane protein, ND3 requires proper insertion into the mitochondrial membrane. The targeting signals and membrane insertion machinery in P. subcordiformis must recognize and process the recombinant ND3 correctly.

  • Complex assembly: In its native context, ND3 functions as part of the larger Complex I assembly. When expressed recombinantly, ensuring proper interaction with other complex components (either native or co-expressed) presents a significant challenge.

  • Oxidative environment: The redox-active nature of Complex I components means that proper disulfide bond formation is critical for function. The expression system must provide the appropriate oxidative environment for these modifications.

  • Stability concerns: Expression studies with recombinant proteins in P. subcordiformis have shown that even with confirmed gene integration, not all transformants produce bioactive proteins. For instance, in the Reteplase expression study, only two of three protein-expressing clones showed the expected bioactivity, suggesting issues with protein folding or stability .

  • PTM machinery compatibility: While P. subcordiformis is a eukaryotic expression host with the advantage of post-translational modification capabilities, species-specific differences in PTM machinery might affect the processing of heterologous proteins.

Addressing these challenges might require co-expression of chaperones or other factors that assist in proper folding and assembly of complex membrane proteins.

How can researchers analyze and interpret variations in ND3 activity across different transformant lines?

Analyzing variations in ND3 activity across different transformant lines requires a multi-faceted approach:

  • Standardized activity assays: Establish consistent protocols for measuring ND3/Complex I activity, such as NADH oxidation rates, ubiquinone reduction, or proton pumping efficiency. Normalize activity to protein expression levels to distinguish between effects on expression versus protein function.

  • Statistical analysis framework:

    • Perform ANOVA with post-hoc tests to identify statistically significant differences between transformant lines

    • Use multiple biological and technical replicates to ensure reproducibility

    • Apply correlation analyses to identify relationships between expression levels and activity

  • Integration site analysis: When variations are observed, sequence the genomic integration sites to determine if position effects contribute to functional differences.

  • Protein structure-function correlation: For transformants with altered activity, sequence the expressed protein and analyze structural models to identify potential mutations or variations that might explain functional differences.

  • Environmental response profiling: Test activity under varying conditions (pH, temperature, ionic strength) to create functional profiles that may reveal subtle differences in protein stability or catalytic properties.

This comprehensive analysis approach helps distinguish between variations due to expression levels, protein folding, subunit assembly, or intrinsic catalytic differences.

What bioinformatic approaches are recommended for analyzing the structure and function of recombinant ND3 in P. subcordiformis?

Bioinformatic analysis of recombinant ND3 structure and function should incorporate:

  • Sequence analysis:

    • Multiple sequence alignment of ND3 across species to identify conserved functional domains

    • Prediction of transmembrane regions and topology using algorithms like TMHMM or Phobius

    • Identification of potential post-translational modification sites

  • Structural modeling:

    • Homology modeling based on the available crystal structure of mitochondrial Complex I

    • Molecular dynamics simulations to predict stability and conformational changes

    • Docking studies with ubiquinone and known inhibitors to identify interaction sites

  • Functional prediction:

    • Analysis of the continuous axis of basic and acidic residues critical for proton translocation

    • Identification of residues involved in the proposed two-state stabilization-change mechanism

    • Prediction of interaction interfaces with other Complex I subunits

  • Data integration:

    • Integration of experimental data with structural models to refine understanding

    • Mapping of mutations or variations onto structural models to explain functional differences

    • Network analysis of protein-protein interactions within the respiratory chain complex

These bioinformatic approaches provide a theoretical framework for interpreting experimental results and guiding further studies on recombinant ND3 function and optimization.

How can researchers troubleshoot discrepancies between gene integration, protein expression, and functional activity of recombinant ND3?

When facing discrepancies between gene integration, protein expression, and functional activity of recombinant ND3, researchers should systematically troubleshoot using this framework:

  • Gene integration verification:

    • Confirm integration using multiple PCR primer sets targeting different regions of the transgene

    • Perform Southern blotting to verify copy number and integrity of the integrated gene

    • Sequence the integration site to identify potential disruptions or rearrangements

  • Transcription analysis:

    • Quantify mRNA levels using RT-qPCR to confirm active transcription

    • Analyze mRNA sequence for potential splice variants or premature stop codons

    • Assess mRNA stability and half-life in different culture conditions

  • Protein expression troubleshooting:

    • Optimize protein extraction protocols specifically for membrane proteins

    • Try different detection methods and antibodies in Western blotting

    • Examine subcellular localization using fractionation or microscopy techniques

  • Functional activity assessment:

    • Test activity under varying conditions that might affect protein folding or stability

    • Examine the presence of endogenous factors that might interfere with activity

    • Consider co-expression of additional subunits or chaperones to enhance proper assembly

This approach parallel's troubleshooting that was necessary in the Reteplase expression study, where only 2 of 4 gene-positive colonies showed protein expression, and only 2 of 3 protein-expressing colonies demonstrated bioactivity , highlighting the importance of multifaceted validation at each step.

What potential applications exist for engineered variants of ND3 expressed in P. subcordiformis?

Engineered variants of ND3 expressed in P. subcordiformis could serve several research and biotechnological purposes:

  • Structural and functional studies:

    • Site-directed mutagenesis of key residues to probe structure-function relationships

    • Creation of tagged variants for interaction studies with other complex components

    • Development of sensors for monitoring respiratory chain activity in vivo

  • Bioenergetic applications:

    • Engineering variants with altered proton pumping efficiency for bioenergetic studies

    • Creating mutants with modified quinone binding sites to study electron transfer mechanisms

    • Developing variants resistant to environmental stressors for fundamental research

  • Biotechnological potential:

    • Using the P. subcordiformis expression system to produce ND3 variants for structural biology

    • Developing algal strains with modified electron transport properties for hydrogen production

    • Creating diagnostic tools for studying mitochondrial disorders related to Complex I

  • Environmental applications:

    • Engineering strains with enhanced energy conversion efficiency for bioremediation

    • Developing biosensors for detecting inhibitors of respiratory chain components

The successful demonstration of bioactive recombinant protein expression in P. subcordiformis provides a foundation for these advanced applications, particularly given the microalga's potential as an oral delivery vehicle through aquaculture food chains .

How might CRISPR-Cas9 gene editing technology be applied to enhance recombinant ND3 expression in P. subcordiformis?

CRISPR-Cas9 technology offers several strategies to enhance recombinant ND3 expression in P. subcordiformis:

  • Targeted integration:

    • Precise insertion of the ND3 gene into genomic hot spots known to support high expression

    • Integration into safe harbor sites to minimize positional effects and prevent disruption of essential genes

    • Multiplexed integration to achieve controlled copy number increases

  • Promoter engineering:

    • Precise modification of endogenous strong promoters to drive ND3 expression

    • Creation of synthetic promoter elements optimized for P. subcordiformis

    • Development of inducible expression systems with tight regulation

  • Host cell engineering:

    • Knockout of competing metabolic pathways to redirect cellular resources

    • Modification of protein degradation pathways to increase recombinant protein stability

    • Enhancement of membrane protein insertion machinery to improve ND3 folding

  • Bioprocess optimization:

    • Engineering of photosynthetic efficiency to increase biomass and protein yields

    • Modification of stress response pathways to improve culture robustness

    • Enhancement of protein secretion or extraction systems for simplified purification

While CRISPR-Cas9 protocols for P. subcordiformis are still developing, the established transformation systems provide a foundation for introducing CRISPR components, potentially revolutionizing recombinant protein expression in this microalgal system.

What interdisciplinary approaches could advance our understanding of ND3 structure-function relationships when expressed in heterologous systems?

Advancing our understanding of ND3 structure-function relationships in heterologous expression systems requires integration of multiple disciplines:

  • Structural biology approaches:

    • Cryo-electron microscopy to determine high-resolution structures of recombinant ND3 in membrane environments

    • Solid-state NMR studies to examine dynamic aspects of the protein within lipid bilayers

    • X-ray crystallography of purified protein in detergent micelles or lipidic cubic phases

  • Biophysical techniques:

    • Single-molecule force spectroscopy to study unfolding pathways and stability

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

    • Electron paramagnetic resonance spectroscopy to examine electron transfer mechanisms

  • Computational biology integration:

    • Molecular dynamics simulations to model protein behavior in different membrane environments

    • Quantum mechanical calculations of electron transfer processes

    • Machine learning approaches to predict optimal expression conditions from experimental data

  • Systems biology perspectives:

    • Metabolic flux analysis to understand the impact of recombinant expression on host physiology

    • Proteomics profiling to identify co-factors that enhance proper folding and assembly

    • Transcriptomics to identify cellular responses to expression of membrane proteins

  • Synthetic biology frameworks:

    • Design of minimal respiratory chain systems with defined components

    • Development of chimeric proteins to investigate domain-specific functions

    • Creation of genetic circuits that respond to respiratory chain activity

The complex structure and function of ND3, with its central role in the proton-pumping machinery of Complex I , makes it particularly amenable to such interdisciplinary investigations, potentially yielding insights applicable to both fundamental bioenergetics and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.