Recombinant Podomys floridanus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products depends on multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize development of the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Podomys floridanus (Florida mouse) (Hesperomys floridanus)
Target Names
Target Protein Sequence
MNMLMILSVNIILSTCLIMIAFWLPQLNVYTEKANPYECGFDPMSSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAIQMHNINMMMSTAFILVSILALGLAYEWLQKGLEWTE
Uniprot No.

Target Background

Function
This protein serves as a core subunit within the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. This function is critical for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its primary function in mitochondrial biology?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) functions as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This essential component catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. MT-ND3 is critical for the catalytic activity of complex I, which represents the first entry point for electrons into the oxidative phosphorylation system . The protein is encoded by mitochondrial DNA (mtDNA) and synthesized within the mitochondria, making it subject to mitochondrial genetic inheritance patterns rather than Mendelian inheritance. In Podomys floridanus, as in other mammals, MT-ND3 would be expected to maintain this fundamental role in cellular energy production.

What expression systems are most effective for producing recombinant MT-ND3 protein?

For recombinant MT-ND3 expression, E. coli-based systems have demonstrated effectiveness, particularly when the protein is fused to affinity tags such as polyhistidine (His-tag) for purification purposes . When expressing MT-ND3 from Podomys floridanus, researchers should consider the following methodological approaches:

  • Vector selection: pET-based expression vectors provide strong induction capabilities

  • Host strain optimization: BL21(DE3) or Rosetta strains may improve expression of this mitochondrial protein

  • Induction conditions: Lower temperatures (16-25°C) often yield better folding for membrane proteins

  • Solubilization strategies: Detergents such as n-dodecyl β-D-maltoside (DDM) may be required for extraction

The methodology must be optimized specifically for Podomys floridanus MT-ND3, as cross-species variations in codon usage and protein folding requirements can significantly impact expression efficiency.

What purification strategies work best for recombinant MT-ND3 protein?

Purification of recombinant MT-ND3 typically involves a multi-step approach:

  • Initial capture using affinity chromatography (e.g., Ni-NTA for His-tagged constructs)

  • Secondary purification using ion exchange chromatography

  • Final polishing step with size exclusion chromatography

A standardized protocol might include:

Purification StepMethodologyBuffer CompositionExpected Yield
Affinity ChromatographyNi-NTA resin50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10-250 mM imidazole gradient70-80% recovery
Ion ExchangeQ-Sepharose20 mM Tris-HCl pH 8.0, 0-500 mM NaCl gradient60-70% recovery
Size ExclusionSuperdex 75/200Tris/PBS-based buffer, pH 8.090-95% recovery

For storage, addition of glycerol (final concentration 6-50%) helps maintain protein stability during freeze-thaw cycles, with recommendations for aliquoting and storage at -20°C or -80°C to avoid repeated freezing and thawing .

How should researchers validate the identity and functionality of purified MT-ND3?

Validation of recombinant MT-ND3 should employ multiple complementary approaches:

  • Identity confirmation:

    • SDS-PAGE analysis (expected MW ~13 kDa)

    • Western blotting using anti-MT-ND3 antibodies (such as those suitable for human MT-ND3)

    • Mass spectrometry validation of peptide fragments

  • Functionality assessment:

    • NADH:ubiquinone oxidoreductase activity assays

    • Complex I assembly analysis using blue native PAGE

    • Mitochondrial respiration studies in reconstituted systems

For immunological detection, antibodies raised against human MT-ND3 may cross-react with Podomys floridanus MT-ND3 due to sequence conservation, enabling immunohistochemical and immunofluorescence applications similar to those demonstrated with human tissues .

What approaches are effective for studying MT-ND3 mutations and their functional impacts?

Investigating MT-ND3 mutations requires sophisticated methodological approaches:

  • Site-directed mutagenesis of recombinant constructs to introduce specific mutations

  • Heteroplasmy modeling in cell culture systems

  • Functional consequences assessment through:

    • Enzyme kinetics analysis

    • Reactive oxygen species (ROS) production measurement

    • Membrane potential evaluation

Research on human MT-ND3 has revealed that point mutations such as m.10191T>C can cause significant pathological conditions including Leigh syndrome with associated epilepsy . This suggests that subtle changes to MT-ND3 sequence can have profound functional consequences. When studying Podomys floridanus MT-ND3, researchers should consider:

  • Species-specific mutation patterns and conservation analysis

  • Heteroplasmy quantification methods (NextGen Sequencing approaches)

  • Comparative analysis with human disease-causing mutations

For mutation analysis, quantitative analysis of heteroplasmic mutant load is possible by counting the number of mtDNA reads using NGS technology, with mapped sequence variants filtered using quality parameters as demonstrated in studies of human MT-ND3 mutations .

How can researchers effectively study the role of MT-ND3 within the larger Complex I structure?

Studying MT-ND3's role within Complex I requires structural and functional approaches:

  • Cryo-electron microscopy (cryo-EM) of purified Complex I

  • Cross-linking studies to identify interacting partners

  • Functional reconstitution experiments with selective subunit omission

Methodologically, researchers can employ:

  • Blue native PAGE to assess complex assembly

  • Proximity labeling techniques (BioID, APEX) to map interaction networks

  • Molecular dynamics simulations based on structural data

In human patients with MT-ND3 mutations, research has demonstrated that mutations disrupt Complex I function leading to mitochondrial disorders . This indicates MT-ND3's critical role within the complex, likely conserved in Podomys floridanus and other mammals.

What are the best approaches for studying MT-ND3 involvement in mitochondrial disorders?

MT-ND3 mutations have been implicated in several mitochondrial disorders, most notably Leigh syndrome with associated epilepsy . Research strategies should include:

  • Patient-derived or engineered cellular models containing MT-ND3 mutations

  • Comprehensive phenotypic characterization:

    • Bioenergetic profiling (Seahorse XF analysis)

    • Mitochondrial network dynamics assessment

    • Transcriptomic and proteomic analysis

Studies have identified that specific mutations like m.10191T>C in MT-ND3 are strongly associated with epilepsy, with 6 out of 7 patients carrying this mutation developing seizures in one cohort study . Three of these patients were diagnosed with Lennox-Gastaut syndrome (LGS), suggesting particular mutation sites may correlate with specific clinical presentations.

For experimental design, researchers should consider:

Research QuestionMethodologyExpected OutcomesConsiderations
Mutation pathogenicityHeteroplasmy modelingThreshold effects on functionMutant load quantification (57.9-93.6% range observed in patients)
Phenotypic spectrumClinical correlationsSeizure types and frequencyNo correlation found between heteroplasmy levels and symptom onset
Treatment responseTherapeutic interventionsEfficacy monitoringConsider ketogenic diet tolerance issues reported in some patients

What comparative approaches can reveal evolutionary insights about MT-ND3 function across species?

Evolutionary studies of MT-ND3 can provide insights into functional conservation:

  • Multiple sequence alignment across diverse species

  • Identification of conserved vs. variable regions

  • Functional domain mapping through conservation analysis

The protein sequence of MT-ND3 is relatively conserved in mammals, with important functional domains maintaining high sequence identity. Comparative studies between Podomys floridanus MT-ND3 and better-characterized homologs such as human MT-ND3 or Bos mutus grunniens MT-ND3 can reveal:

  • Species-specific adaptations

  • Conserved catalytic residues

  • Structural elements critical for Complex I assembly

For Podomys floridanus MT-ND3, researchers should compare the 115-amino acid sequence with that of other mammals, particularly focusing on regions known to harbor pathogenic mutations in humans, such as the position equivalent to the human m.10191T>C mutation .

What immunological techniques are most effective for studying MT-ND3 expression and localization?

MT-ND3 detection and localization can be achieved through several immunological techniques:

  • Immunohistochemistry (IHC-P) on paraffin-embedded tissues

  • Immunofluorescence (ICC/IF) in cultured cells

  • Immunoblotting for protein expression quantification

For optimal results, researchers should:

  • Use antibodies validated for cross-reactivity with Podomys floridanus MT-ND3

  • Include appropriate controls (positive, negative, and isotype)

  • Optimize fixation and permeabilization conditions (PFA/Triton X-100 has shown effectiveness)

Immunofluorescence studies have successfully detected MT-ND3 in human MCF7 cells using antibodies at 4 μg/mL concentration, and similar approaches could be adapted for Podomys floridanus samples with appropriate validation .

How can researchers effectively study the interaction between MT-ND3 and other Complex I subunits?

Studying protein-protein interactions involving MT-ND3 requires specialized techniques:

  • Co-immunoprecipitation with antibodies against MT-ND3 or interacting partners

  • Proximity labeling approaches (BioID, APEX2)

  • Förster resonance energy transfer (FRET) for direct interaction verification

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for mapping interaction surfaces

These methodologies can help elucidate how MT-ND3 contributes to Complex I assembly and function, including potential species-specific interaction patterns in Podomys floridanus.

What are the challenges and solutions for working with recombinant mitochondrial membrane proteins like MT-ND3?

Working with mitochondrial membrane proteins presents several technical challenges:

  • Expression difficulties:

    • Toxicity to host cells

    • Inclusion body formation

    • Improper folding

  • Solubilization complexities:

    • Detergent selection critical

    • Potential loss of structure/function

    • Aggregation tendencies

For recombinant Podomys floridanus MT-ND3, researchers should consider:

ChallengeSolution ApproachMethodological Notes
Expression toxicityTunable expression systemsUse tight promoter control, lower induction temperatures (16-20°C)
Protein solubilizationDetergent screeningTest mild detergents (DDM, digitonin) and lipid nanodisc reconstitution
Functional assessmentActivity assaysReconstitute with other Complex I components for activity measurement
Storage stabilityBuffer optimizationIncorporate 6-50% glycerol and store at -80°C in small aliquots

The reconstitution buffer composition is critical, with recommendations for Tris/PBS-based buffers with trehalose (6%) at pH 8.0 showing effectiveness for similar proteins .

How might MT-ND3 research contribute to understanding mitochondrial disease mechanisms?

MT-ND3 research offers significant potential for advancing mitochondrial disease understanding:

  • Genotype-phenotype correlations:

    • MT-ND3 mutations like m.10191T>C show strong associations with specific phenotypes such as epilepsy and Lennox-Gastaut syndrome

    • No significant correlation between heteroplasmy levels and symptom onset has been observed, suggesting complex disease mechanisms

  • Disease model development:

    • MT-ND3 mutations can be introduced in cellular and animal models

    • Resulting phenotypes can help elucidate disease progression

  • Therapeutic target identification:

    • Understanding MT-ND3's role in Complex I may reveal intervention points

    • Metabolic bypass strategies might be developed based on MT-ND3 dysfunction mechanisms

Research on MT-ND3 in diverse species, including Podomys floridanus, could provide comparative insights that illuminate evolutionary adaptations relevant to disease susceptibility or resistance.

What are the implications of MT-ND3 research for broader fields such as aging and neurodegeneration?

MT-ND3 research has implications beyond primary mitochondrial diseases:

  • Aging biology:

    • Mitochondrial dysfunction is a hallmark of aging

    • MT-ND3 mutations may accumulate with age, contributing to bioenergetic decline

  • Neurodegenerative conditions:

    • Complex I deficiency is implicated in Parkinson's disease pathogenesis

    • MT-ND3 variants may modify disease risk or progression

  • Metabolic disorders:

    • Complex I is central to cellular energy production

    • MT-ND3 dysfunction may contribute to metabolic syndrome components

The strong association between MT-ND3 mutations and neurological manifestations suggests particular importance in brain energy metabolism, with potential relevance to numerous neurological conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.