Recombinant Podospora anserina Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
RCF1; AIM31; Pa_5_5310; Pa5G0002; PODANS_5_5310; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-218
Protein Length
full length protein
Species
Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina)
Target Names
RCF1
Target Protein Sequence
MSNGPLSNRPLPSSFDSNDDFYNENGFQKVLRRLKEEPLVPIGCLLTVAAFTNAYRAMRR GDHAKVQKMFRARVAAQAFTVVAMVAGGMYYQADRHKQKELWKLRQQKDAEEKHQKWIRE LEARDAEEKALQERLDKRRKRAAERAGGTGTESVAAQARAALRESKAGKTETGEATSTEA NQADGGVLGSLGGWFGGSKKAPEDTTPALESKPEDPKN
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.
Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Podospora anserina and why is it used as a model organism?

Podospora anserina is a filamentous ascomycete fungus that has been extensively used as a model organism in molecular genetics laboratories. It belongs to the order Sordariales and is part of a complex of seven closely related species . This fungus is particularly valuable to researchers because:

  • It has a relatively small genome (approximately 35 Mb arranged in 7 chromosomes)

  • Its sexual cycle completes within a week, allowing for rapid genetic analysis

  • It exhibits pronounced phenotypic senescence when grown on solid medium but possesses unlimited lifespan under submerged cultivation, making it ideal for aging studies

  • It demonstrates a clear relationship between mitochondrial function and aging

  • It is easy to culture and manipulate genetically

These characteristics make P. anserina an excellent model for studying fundamental biological processes, including aging, meiosis, prion biology, sexual reproduction, heterokaryon formation, and hyphal interference .

What is the relationship between mitochondria and aging in Podospora anserina?

In P. anserina, aging is systematically associated with mitochondrial DNA instability . Key aspects of this relationship include:

  • The respiratory function is a key determinant of lifespan in P. anserina

  • Loss of function of the cytochrome pathway leads to:

    • Compensatory induction of an alternative oxidase (AOX)

    • Decreased production of reactive oxygen species (ROS)

    • Increased lifespan

    • Stabilization of mitochondrial DNA

This relationship is supported by experimental evidence:

  • In cytochrome-deficient mutants, decreased ROS production is consistently accompanied by mitochondrial DNA stability and increased lifespan

  • Restoration of wild-type levels of ROS in these mutants is accompanied by mitochondrial DNA instability and decreased lifespan

  • Overexpression of AOX in cytochrome-deficient mutants leads to improved growth rate and fertility, associated with restoration of wild-type levels of ROS, mitochondrial DNA instability, and senescence

These findings establish P. anserina as a valuable model for studying the links between mitochondrial function, ROS production, mitochondrial DNA stability, and aging.

How can recombinant AIM31 protein be expressed and purified for functional studies?

Based on established protocols for recombinant AIM31 production, the following methodological approach is recommended:

Expression system and conditions:

  • Expression host: E. coli is the preferred expression system

  • Expression construct: Full-length protein (1-218 amino acids) with N-terminal His-tag

  • Induction parameters: Optimize temperature, inducer concentration, and induction time for maximum expression

Purification strategy:

  • Affinity chromatography using Ni-NTA resin to capture the His-tagged protein

  • Consider additional purification steps such as ion exchange or size exclusion chromatography if higher purity is required

  • Quality control: Verify purity by SDS-PAGE (should be greater than 90%)

Storage and stability:

  • Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Storage conditions: Store at -20°C/-80°C, aliquoting is necessary for multiple use

  • For long-term storage, the protein can be lyophilized or supplemented with 5-50% glycerol

  • Reconstitution: Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Avoid repeated freeze-thaw cycles to maintain protein integrity

This approach provides a foundation for obtaining high-quality recombinant AIM31 protein suitable for biochemical and structural studies.

What experimental approaches can be used to study AIM31 function in mitochondrial inheritance?

Understanding AIM31's role in mitochondrial inheritance requires multiple complementary approaches:

Genetic approaches:

  • Gene knockout or knockdown studies to understand loss-of-function phenotypes

  • Complementation assays using orthologous genes from related species or modified versions of AIM31

  • Site-directed mutagenesis to identify critical functional residues

Cellular and biochemical approaches:

  • Mitochondrial morphology and distribution analysis using fluorescence microscopy

  • Respiratory chain complex assembly analysis using Blue Native PAGE

  • Measurement of mitochondrial membrane potential and ROS production

  • Analysis of mitochondrial DNA stability in wild-type versus AIM31 mutant strains

Long-term experimental approaches:

  • Experimental evolution studies to identify adaptive mutations in AIM31, similar to the P. anserina long-term evolution experiment (PaLTEE)

  • Analysis of parallel evolution to identify key functional residues - the PaLTEE demonstrated parallel evolution at both gene and protein function levels

Experimental design considerations:

  • Quasi-experimental study designs may be appropriate when randomization is not feasible

  • Designs should include appropriate controls and consider potential confounding variables

  • Time series analyses can provide insights into age-dependent changes in AIM31 function

How does AIM31 contribute to mitochondrial DNA stability and lifespan regulation?

The role of AIM31 in mitochondrial DNA stability and lifespan regulation can be investigated through several research approaches:

Mechanistic studies:

  • Analysis of mitochondrial DNA rearrangements and mutations in AIM31 mutants compared to wild-type

  • Investigation of how AIM31 affects respiratory chain complex assembly and electron transport

  • Examination of the relationship between AIM31, membrane potential, and ROS production

Comparative approaches:

  • Analysis of mitochondrial DNA stability during aging in wild-type versus AIM31 mutant strains

  • Comparison of chronological lifespan under various growth conditions

  • Study of genetic interactions between AIM31 and other known regulators of mitochondrial function and lifespan

Molecular approaches:

  • Investigation of AIM31's potential role in mitochondrial base excision repair (BER), which shows decreased activity during aging in P. anserina

  • Analysis of whether AIM31 affects the balance between cytochrome-dependent respiration and alternative oxidase-dependent respiration

  • Examination of whether AIM31 influences mitochondrial protein quality control systems

Given that cytochrome-deficient mutants in P. anserina show decreased ROS production, increased mitochondrial DNA stability, and extended lifespan , determining AIM31's relationship to these pathways is particularly relevant.

What is known about AIM31 evolution in the Podospora anserina species complex?

Evolutionary analysis of AIM31 across the P. anserina species complex can provide insights into its functional importance:

Genomic context:

  • The P. anserina species complex consists of 7 closely related species with genomes of around 35 Mb arranged in 7 chromosomes

  • These genomes are mostly collinear and less than 2% divergent from each other in genic regions

  • Significant levels of phylogenetic conflict exist within the complex, indicating rapid and recent diversification

Evolutionary approaches:

  • Sequence conservation analysis to identify functionally important domains and residues

  • Synteny analysis to determine if AIM31 is located in regions with special chromosomal features

  • Calculation of selective pressure (dN/dS ratios) to determine if AIM31 is under purifying selection or positive selection

Comparative functional studies:

  • Test functional complementation of AIM31 across species within the complex

  • Analyze whether AIM31 function correlates with differences in lifespan or mitochondrial stability across species

  • Investigate if AIM31 is part of parallel evolution pathways identified in long-term evolution experiments

The high-quality genome assemblies available for all 7 species in the P. anserina complex provide an excellent resource for these evolutionary analyses.

What approaches can be used to study interactions between AIM31 and other mitochondrial proteins?

To elucidate AIM31's protein interaction network, multiple complementary approaches are recommended:

In vivo interaction studies:

  • Co-immunoprecipitation using tagged versions of AIM31

  • Proximity labeling methods (BioID, APEX) to identify neighboring proteins

  • Split reporter systems (e.g., split-GFP) to visualize interactions in living cells

In vitro interaction studies:

  • Pull-down assays using recombinant AIM31 protein

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to measure binding kinetics and thermodynamics

  • Crosslinking mass spectrometry to map interaction interfaces

Functional interaction studies:

  • Genetic interaction screens to identify synthetic lethal or suppressor relationships

  • Epistasis analysis to determine functional relationships with known mitochondrial proteins

  • Analysis of respiratory chain complex assembly in the presence and absence of functional AIM31

The well-characterized mitochondrial pathways in P. anserina provide context for understanding AIM31's interactions and functional role within the mitochondrial network.

How can AIM31 research contribute to understanding fungal mitochondrial inheritance mechanisms?

Research on AIM31 in P. anserina offers several opportunities for broader understanding of fungal mitochondrial inheritance:

Fundamental mechanisms:

  • Elucidation of the molecular basis of maternal inheritance, which has been observed in P. anserina mitochondrial mutations

  • Understanding the role of AIM31 in mitochondrial segregation during cell division

  • Investigation of how AIM31 contributes to mitochondrial DNA stability over time

Comparative approaches:

  • Analysis of AIM31 function in related fungi with different patterns of mitochondrial inheritance

  • Comparison with homologous proteins in other fungal species to identify conserved mechanisms

  • Investigation of whether AIM31 affects mitochondrial inheritance during sexual reproduction

The established phenomenon of strict maternal inheritance of cytoplasmic mutations in P. anserina provides context for understanding AIM31's potential role in this process.

What experimental design is most appropriate for studying AIM31 function in aging?

When designing experiments to study AIM31's role in aging, several approaches should be considered:

Longitudinal studies:

  • Track changes in AIM31 expression, localization, and function during the aging process

  • Monitor mitochondrial DNA stability in wild-type versus AIM31 mutant strains over time

  • Compare chronological lifespan under various growth conditions

Experimental evolution approach:

  • Conduct long-term evolution experiments similar to the PaLTEE

  • Analyze whether mutations in AIM31 arise and fix during adaptation to different growth conditions

  • Investigate parallel evolution to identify key functional residues

Quasi-experimental designs:

  • Use interrupted time series designs to study the effects of interventions on AIM31 function and aging

  • Employ pre-post designs with non-equivalent control groups when randomization is not feasible

  • Consider stepped wedge designs for interventions that must be implemented sequentially

Study Design CategoryDescriptionApplication to AIM31 Research
A. One-group posttest-onlyMeasure outcomes after interventionBasic screening of AIM31 mutant phenotypes
B. One-group pretest-posttestCompare before and after interventionTrack AIM31 function changes during aging
C. Interrupted time seriesMultiple measurements before and after interventionStudy effects of interventions on AIM31-dependent aging
D. Controlled trialsControl group comparison designsCompare wild-type and AIM31 mutant aging trajectories

How can genome editing techniques be applied to study AIM31 function in Podospora anserina?

Modern genome editing approaches offer powerful tools for studying AIM31 function:

CRISPR-Cas9 applications:

  • Generate precise knockout strains to study complete loss of function

  • Create specific point mutations to study structure-function relationships

  • Insert epitope tags for protein localization and interaction studies

  • Implement conditional expression systems to control AIM31 expression temporally

Methodological considerations:

  • Optimize transformation protocols specific for P. anserina

  • Design efficient screening methods to identify successful edits

  • Verify edits by sequencing and functional complementation

  • Consider potential off-target effects and validate with appropriate controls

Phenotypic analyses:

  • Assess growth, development, and lifespan in edited strains

  • Analyze mitochondrial morphology, distribution, and inheritance

  • Measure respiratory capacity and ROS production

  • Evaluate mitochondrial DNA stability over time

Given the importance of AIM31 in mitochondrial function, careful phenotypic characterization of genome-edited strains is essential to understand its role in P. anserina biology.

What methodological approaches can resolve contradictory findings about AIM31 function?

When faced with contradictory findings regarding AIM31 function, several methodological approaches can help resolve discrepancies:

Experimental validation:

  • Reproduce experiments under strictly controlled conditions

  • Use multiple complementary techniques to measure the same parameter

  • Implement blind analysis to reduce experimenter bias

  • Perform biological replicates with appropriate statistical analysis

Strain and environmental considerations:

  • Verify the genetic background of strains used in different studies

  • Control for environmental variables that might affect mitochondrial function

  • Consider strain-specific differences in AIM31 function or regulation

  • Test across multiple strains from the P. anserina species complex

Molecular approaches:

  • Generate allelic series to test dose-dependent effects

  • Create domain-specific mutations to identify critical functional regions

  • Use complementation studies with orthologs from related species

  • Employ epistasis analysis to position AIM31 in signaling pathways

Systems biology approaches:

  • Conduct multi-omics analyses to understand context-dependent effects

  • Model AIM31 function in the context of mitochondrial networks

  • Consider how genetic background might influence AIM31 phenotypes

  • Integrate data across multiple experimental platforms

This comprehensive approach can help resolve contradictions and provide a more complete understanding of AIM31 function.

How might AIM31 research contribute to understanding human mitochondrial diseases?

Research on AIM31 in P. anserina may provide insights relevant to human mitochondrial diseases through:

Comparative analysis:

  • Identification of human homologs of AIM31 and their potential roles in disease

  • Understanding conserved mechanisms of mitochondrial respiratory chain organization

  • Elucidation of fundamental processes in mitochondrial DNA stability and inheritance

Mechanistic insights:

  • Understanding how defects in respiratory chain organization contribute to mitochondrial dysfunction

  • Identifying potential therapeutic targets for mitochondrial diseases

  • Developing interventions to stabilize mitochondrial DNA and prevent age-related accumulation of mutations

Model system advantages:

  • P. anserina provides a tractable experimental system for studying mitochondrial function

  • The clear relationship between mitochondrial function and aging in P. anserina parallels aspects of human aging

  • The wealth of genetic and molecular tools available for P. anserina facilitates detailed mechanistic studies

While direct translation to human health requires caution, fundamental insights from P. anserina AIM31 research may contribute to our understanding of conserved mitochondrial processes relevant to human disease.

What emerging technologies might advance research on AIM31 and mitochondrial function?

Several emerging technologies hold promise for advancing AIM31 research:

Single-cell approaches:

  • Single-cell transcriptomics to analyze cell-to-cell variation in AIM31 expression

  • Single-cell proteomics to study protein-level changes in mitochondrial composition

  • Live-cell imaging at single-mitochondrion resolution to track inheritance and dynamics

Advanced microscopy:

  • Super-resolution microscopy to visualize AIM31 localization within mitochondrial subcompartments

  • Correlative light and electron microscopy to link AIM31 function to mitochondrial ultrastructure

  • Live imaging of mitochondrial dynamics in relation to AIM31 distribution

Integrative multi-omics:

  • Integration of genomics, transcriptomics, proteomics, and metabolomics data

  • Analysis of mitochondrial-nuclear communication through multi-omics approaches

  • Computational modeling of mitochondrial networks incorporating AIM31 function

High-throughput functional genomics:

  • CRISPR screens to identify genetic interactors of AIM31

  • Synthetic genetic array analysis to map functional interactions

  • Automated phenotyping platforms for systematic characterization of mutants

These emerging technologies, applied to the well-established P. anserina model system, promise to provide new insights into the role of AIM31 in mitochondrial function and aging.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.