Recombinant Podospora anserina Alternative oxidase, mitochondrial (AOX1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.

Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The specific tag type is determined during production. To request a specific tag, please indicate your preference; we will prioritize its incorporation.

Synonyms
AOX1; AOX; Alternative oxidase, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
67-363
Protein Length
Full Length of Mature Protein
Species
Podospora anserina (Pleurage anserina)
Target Names
Target Protein Sequence
LKDFFPVKETAYIRKTPPAWPHHGYTEEEMLAVVPQHRKPGSLSDWLAWKLVRLCRWGTD IATGIKPEQQVDKSNPTTAVAAQKPLTEAQWLVRFIFLESIAGVPGMVAGMLRHLESLRR LKRDNGWIETLLEESYNERMHLLTFMKMCEPGWFMKTMILGAQGVFFNAMFLSYLISPRI THRFVGYLEEEAVHTYTRCIREIEQGDLPKWSDPNFQIPDLAVTYWKMPEGKRTMRDLIL YIRADEAVHRGVNHTLSNLNHKEDPNPFVSDYKCDADHQRPNPALKPTGFERSEVIG
Uniprot No.

Target Background

Function

This recombinant Podospora anserina Alternative oxidase, mitochondrial (AOX1) catalyzes cyanide-resistant oxygen consumption. It may enhance respiration under conditions of cytochrome pathway restriction or low temperatures.

Protein Families
Alternative oxidase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein; Matrix side.

Q&A

What is Alternative Oxidase (AOX1) in Podospora anserina and what is its biological significance?

Alternative Oxidase in Podospora anserina (PaAox) is a nuclear-encoded mitochondrial protein that catalyzes the alternative respiratory pathway. Unlike the standard respiratory chain, AOX transfers electrons directly from ubiquinol to oxygen, bypassing complexes III and IV.

Biologically, AOX1 functions as a critical security valve during respiratory stress, preventing excess reactive oxygen species (ROS) formation. In P. anserina specifically, copper depletion leads to the induction of this alternative respiratory pathway through the expression of PaAox, which compensates for mitochondrial dysfunctions and contributes to increased lifespan . This resembles the retrograde response observed in Saccharomyces cerevisiae and appears to be specifically induced by impairments of the copper-dependent cytochrome c oxidase rather than by general decline of mitochondrial functions during senescence .

Methodologically, researchers can analyze AOX1 significance through comparative lifespan studies between wild-type strains and those with manipulated AOX1 expression levels, while monitoring respiratory capacity and ROS production.

How is AOX1 expression regulated in response to environmental conditions?

AOX1 expression in P. anserina demonstrates sophisticated regulation patterns in response to cellular copper levels and oxidative stress. Research has shown that:

  • Copper depletion induces PaAox expression

  • Elevated levels of cellular copper decrease PaAox transcript levels

  • Increased superoxide and hydrogen peroxide levels reduce PaAox transcription

  • Copper also controls transcript levels of PaSod2, the gene encoding mitochondrial manganese superoxide dismutase

These findings indicate that AOX1 expression is inversely correlated with cellular copper availability and oxidative stress markers. This regulation appears to be part of a coordinated response to maintain mitochondrial function under adverse conditions.

To investigate this regulation experimentally, researchers should:

  • Use copper chelators (e.g., BCS at 33 μM with 1 mM ascorbic acid) to induce AOX1 expression

  • Employ quantitative PCR to measure transcript levels under different conditions

  • Monitor cellular copper distribution during aging using appropriate markers

  • Correlate changes in expression with mitochondrial function parameters

What methods are effective for measuring AOX1 activity in fungal models?

Several complementary approaches can be employed to measure AOX1 activity in fungal models:

  • Oxygen consumption measurements: Using high-resolution respirometry (e.g., Oxygraph-2k) to measure oxygen consumption in the presence of specific inhibitors. AOX-dependent respiration can be quantified by measuring oxygen consumption that is resistant to potassium cyanide (KCN, which inhibits complex IV) but sensitive to alternative oxidase inhibitors like n-octylgallate (nOG) or salicylhydroxamic acid (SHAM) .

  • Western blot analysis: Using antibodies against AOX to quantify protein levels in mitochondrial fractions. While species-specific antibodies are preferred, cross-reactive antibodies (such as those raised against plant AOX from S. guttatum) have been successfully used to detect fungal AOX proteins .

  • Fluorescence microscopy: Using GFP-tagged AOX1 constructs to visualize localization and relative abundance in living cells. This approach allows for monitoring dynamic changes in AOX1 expression and localization in response to different growth conditions or aging .

Sample protocol for oxygen consumption measurement:

  • Cultivate fungal strains under controlled conditions

  • Transfer mycelium pieces into a high-resolution respirometer

  • Measure baseline oxygen consumption

  • Add 1 mM KCN to inhibit complex IV-dependent respiration

  • Measure remaining respiration (AOX-dependent)

  • Add 4-6 mM SHAM or 6.0 μM nOG to inhibit AOX

  • Calculate AOX capacity as the difference between oxygen consumption after KCN addition and after AOX inhibitor addition

How does AOX1 expression change during the aging process?

AOX1 expression demonstrates distinct patterns during the aging process in P. anserina:

  • During aging, there is a pronounced switch from standard complex IV-dependent respiration to alternative respiration involving AOX1 .

  • This transition correlates with age-dependent alterations of mitochondrial protein complexes, particularly:

    • Loss of mitochondrial respiratory supercomplexes (mtRSCs)

    • Reduction in the abundance of complex I and complex IV

  • The induction of alternative respiration appears to be a compensatory mechanism as standard respiratory pathways become impaired with age.

For experimental investigation, researchers should:

  • Compare young (6 days) and aged (18 days) cultures grown under standardized conditions

  • Isolate mitochondria for complexome profiling to assess the integrity of respiratory complexes

  • Measure COX-dependent and AOX-dependent oxygen consumption using specific inhibitors

  • Correlate changes in respiratory pathways with other aging markers

What are the structural and functional differences between AOX1 in P. anserina and alternative oxidases in other organisms?

Alternative oxidases across different species share functional similarities but exhibit important structural and regulatory differences that influence their specific roles in each organism:

Comparative analysis of alternative oxidases:

OrganismGeneSizeRegulationFunctionSpecific Features
P. anserinaPaAox~1.4 kb cDNAInduced by copper depletion; repressed by high copper, superoxide, and H₂O₂Extends lifespan; compensates for mitochondrial dysfunctionPart of coordinated response with PaSod2
Ustilago maydisAox1~49 kDaSpecifically induced during stationary phaseDispensable for normal growth but essential for coping with respiratory stressNot detected during exponential growth or when grown on non-glucose carbon sources
Plants (e.g., S. guttatum)AOXVariableOften induced by stress conditionsThermogenesis in some species; stress responseWell-characterized role in heat production for volatile distribution

Methodologically, researchers should approach comparative studies through:

  • Sequence alignment and phylogenetic analysis

  • Recombinant expression of different AOX proteins for biochemical characterization

  • Complementation studies in deletion mutants

  • Structure-function analysis through mutagenesis of conserved residues

How can recombinant P. anserina AOX1 be efficiently produced for structural and functional studies?

Efficient production of recombinant P. anserina AOX1 requires careful optimization of expression systems and purification protocols:

Recommended expression strategy:

  • Construct design:

    • Clone the full PaAox cDNA (approximately 1.4 kb)

    • Add a C-terminal His-tag or other affinity tag for purification

    • Consider including the native 5' UTR (65 bp) which may enhance expression

  • Expression system options:

    • E. coli: Suitable for producing partial AOX1 constructs, similar to the approach used for human AOX1 (236-421 aa fragment)

    • Yeast: Better for full-length functional protein due to improved folding and potential post-translational modifications

    • Homologous expression: Creating a tagged version in P. anserina itself for physiological studies, as demonstrated with Aox1-GFP fusions in U. maydis

  • Functional verification:

    • Confirm activity using oxygen consumption measurements with specific inhibitors

    • Verify proper mitochondrial localization using fluorescence microscopy if a GFP tag is used

    • Test complementation of aox1Δ mutants to confirm functionality

When using E. coli, researchers should note that while this system can successfully express human AOX1 fragments , the full-length fungal protein may require optimization of codons and growth conditions to achieve proper folding and activity.

What experimental approaches can effectively assess the impact of AOX1 on lifespan extension?

To rigorously evaluate the impact of AOX1 on lifespan extension, researchers should employ a multi-faceted experimental approach:

  • Genetic manipulation strategies:

    • Generate AOX1 deletion strains (aox1Δ)

    • Create overexpression strains using constitutive (e.g., Potef) or inducible promoters

    • Develop strains expressing tagged versions (e.g., AOX1-GFP) for localization studies

  • Lifespan analysis protocols:

    • Standardize growth conditions (media composition, temperature, light)

    • Measure lifespans of multiple independent isolates (n≥20) for statistical significance

    • Compare wild-type, knockout, and overexpression strains

  • Physiological parameters to monitor:

    • Respiratory capacity using high-resolution respirometry

    • ROS production using specific fluorescent probes

    • Mitochondrial morphology and integrity using electron microscopy

    • Age-dependent changes in respiratory complex assembly using complexome profiling

  • Environmental manipulations:

    • Copper depletion using chelators (e.g., 33 μM BCS with 1 mM ascorbic acid)

    • Respiratory inhibitors (e.g., KCN, nOG, SHAM) at sub-lethal concentrations

    • Various carbon sources to modulate metabolic state

This comprehensive approach enables researchers to establish causality between AOX1 activity and lifespan effects while elucidating the underlying mechanisms.

How do regulatory networks coordinate AOX1 expression with other stress response systems?

AOX1 expression is integrated within complex regulatory networks that coordinate various stress response systems:

  • Copper-dependent regulation:

    • Copper depletion induces PaAox expression in P. anserina

    • Copper also controls transcript levels of PaSod2 (mitochondrial manganese superoxide dismutase)

    • This suggests coordinate regulation of the alternative respiratory pathway and antioxidant defense systems

  • Growth phase-dependent regulation:

    • In U. maydis, Aox1 is specifically induced during stationary phase but not detected during exponential growth

    • This growth phase-dependent regulation suggests links to nutrient sensing and stress response pathways

  • Carbon source-dependent regulation:

    • Aox1 expression in U. maydis is detected in glucose-grown cells but not in cells grown on ethanol, glycerol, or lactate

    • This indicates integration with metabolic regulatory networks

  • ROS-mediated signaling:

    • PaAox transcript levels decrease when cellular superoxide and hydrogen peroxide levels are raised

    • This suggests feedback regulation involving ROS sensing mechanisms

To experimentally investigate these regulatory networks, researchers should:

  • Perform transcriptome analysis under various stress conditions

  • Identify transcription factors binding to the AOX1 promoter region

  • Use chromatin immunoprecipitation (ChIP) to characterize protein-DNA interactions

  • Employ metabolic flux analysis to understand how AOX1 regulation integrates with cellular metabolism

What methodological considerations are important when integrating AOX1 studies across different model organisms?

When integrating AOX1 research across different model organisms, researchers must consider several methodological factors:

  • Evolutionary context:

    • Alternative oxidases are found across different kingdoms with varying functions

    • Phylogenetic analysis should precede functional comparisons

    • Human AOX1 functions differ significantly from fungal and plant AOX proteins, despite the shared name

  • Functional assay standardization:

    • Respiratory measurements should use comparable inhibitor concentrations (e.g., 1 mM KCN, 4-6 mM SHAM)

    • Growth conditions must be standardized when comparing across species

    • Age-related studies must account for the different lifespans of model organisms

  • Cross-species protein expression:

    • When expressing AOX from one species in another, consider codon optimization

    • Verify proper subcellular localization

    • Confirm functionality through complementation and enzyme activity assays

  • Comparative pathway analysis:

    • In P. anserina, AOX is linked to aging and lifespan extension

    • In U. maydis, Aox1 is primarily involved in respiratory stress response

    • In humans, AOX1 has been implicated in osteogenic differentiation

These considerations ensure that researchers can accurately interpret findings across different model systems while accounting for the specific biological contexts in which AOX functions.

What are the optimal conditions for measuring AOX1 enzyme kinetics in isolated mitochondria?

For accurate determination of AOX1 enzyme kinetics in isolated mitochondria, researchers should optimize several critical parameters:

  • Mitochondrial isolation protocol:

    • Use standardized procedures for isolating intact mitochondria from fungal mycelium

    • Confirm mitochondrial integrity through respiratory control ratios

    • Determine protein concentration using Bradford or BCA assays

  • Reaction conditions:

    • Buffer composition: typically 0.3 M mannitol, 10 mM KH₂PO₄, 5 mM MgCl₂, 10 mM KCl, pH 7.2

    • Temperature: maintain at physiologically relevant temperature (27°C for P. anserina)

    • Substrate concentrations: use range of ubiquinol concentrations for Michaelis-Menten kinetics

  • Measurement protocol:

    • Use high-resolution respirometry (e.g., Oxygraph-2k)

    • Add complex III inhibitor (e.g., antimycin A) to prevent electron flow through the conventional pathway

    • Measure oxygen consumption rates at different substrate concentrations

    • Add AOX-specific inhibitor (SHAM or nOG) to confirm AOX-dependent activity

  • Data analysis:

    • Calculate Km and Vmax using nonlinear regression

    • Normalize activity to mitochondrial protein content

    • Compare samples harvested at different growth phases or under different stress conditions

This methodological approach enables precise characterization of AOX1 enzyme kinetics, facilitating comparative studies across different experimental conditions or genetic backgrounds.

How can researchers effectively analyze the interaction between AOX1 and mitochondrial respiratory complexes?

Analyzing interactions between AOX1 and mitochondrial respiratory complexes requires sophisticated techniques to preserve native protein-protein interactions:

  • Complexome profiling:

    • This technique allows age-dependent alterations of assembled mitochondrial protein complexes to be detected

    • It can reveal changes in the abundance of respiratory supercomplexes and individual complexes

    • The methodology involves blue native PAGE combined with mass spectrometry

  • Blue Native PAGE analysis:

    • Solubilize mitochondria with mild detergents (e.g., digitonin) to preserve native complexes

    • Separate complexes by size on gradient gels

    • Perform western blotting with antibodies against AOX1 and respiratory complex components

    • Look for co-migration that may indicate physical association

  • Co-immunoprecipitation studies:

    • Use antibodies against AOX1 or tagged versions (e.g., AOX1-GFP) for pull-down experiments

    • Identify interacting proteins through mass spectrometry

    • Confirm specific interactions through reciprocal co-immunoprecipitations

  • Functional interaction studies:

    • Measure respiratory capacity in the presence of inhibitors targeting specific complexes

    • Analyze how AOX1 induction affects the assembly and stability of respiratory complexes

    • Investigate electron flow distribution between conventional and alternative pathways

These methodological approaches can reveal whether AOX1 physically interacts with respiratory complexes or whether its effects are primarily through metabolic rewiring of electron flow pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.