Recombinant Podospora anserina ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Biological Role of ATP6 in P. anserina

ATP synthase subunit a (ATP6) is an integral component of the mitochondrial F₀ domain, which facilitates proton translocation across the inner membrane to drive ATP synthesis. In Podospora anserina, ATP6 works in concert with c-subunits (encoded by paralogous genes Atp9-5 and Atp9-7) to modulate ATP synthase activity . Key findings include:

  • Expression Dynamics: Atp9-5 (highly active in proliferating cells) supports ATP synthase assembly with higher ATP synthesis efficiency (~20% more ATP per electron transfer) compared to Atp9-7 (active in stationary cells) .

  • Longevity Effects: ATP6 interactions with c-subunits influence lifespan; ATP9-5-associated complexes extend longevity, while ATP9-7 shortens it .

Recombinant ATP6 Production

The recombinant ATP6 protein (UniProt ID: P15994) is expressed in Escherichia coli and purified via affinity chromatography using its His tag .

ParameterDetails
Host OrganismEscherichia coli
TagN-terminal His tag
Amino Acid Range1-264aa (Full length)
ApplicationStructural studies, enzyme kinetics, and mitochondrial disease research

Functional Insights from Mutational Studies

  • Assembly and Stability: Mutations in ATP6 (e.g., p.I164V, p.G167S) do not disrupt ATP synthase dimer/monomer formation in yeast models, suggesting robust structural resilience .

  • ATP Synthesis Efficiency: Mutant ATP6 subunits (e.g., p.Y212H) reduce ATP yield by ~15% in galactose-grown cells at 36°C, highlighting residues critical for proton coupling .

Regulatory Mechanisms

  • Dual c-Subunit System: P. anserina employs two c-subunit isoforms (ATP9-5 and ATP9-7) to optimize ATP synthase activity across growth phases. ATP9-5 elevates mitochondrial ATP production by 30% compared to ATP9-7 .

Applications in Biomedical Research

Recombinant ATP6 is used to:

  • Study mitochondrial disorders linked to ATP synthase dysfunction (e.g., Leigh syndrome) .

  • Investigate aging mechanisms, leveraging P. anserina’s well-characterized lifespan modulation via ATP synthase activity .

  • Develop targeted therapies for diseases caused by MT-ATP6 mutations .

Key Comparative Data

ParameterATP9-5-Associated ATP6ATP9-7-Associated ATP6
ATP Synthesis Rate8.2 µmol/min/mg protein6.5 µmol/min/mg protein
Longevity ImpactExtended lifespanReduced lifespan
Expression PhaseActive in apical cellsActive in stationary cells

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina)
Target Names
ATP6
Target Protein Sequence
MNTLFNTVNFWRYNSSPLTQFEIKDLISIDTPILGNLHISITNIGFYLTMGAFFLLIINL LSTNYNKLIGNSWSISQESLYATLHSIVVNQINPKNGQIYFPFIYALFIFILINNLIGMV PYSFASTSHFVLTFALSFTIVLGATILGFQKHGLEFFSLLVPAGCPLGLLPLLVLIEFIS YLARNISLGLRLAANILSGHMLLHILAGFTYNIMTSGIIFFFLGLIPLAFIIAFSGLELG IAFIQAQVFVVLTSGYIKDALDLH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane, which is established by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the proton channel and may play a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Podospora anserina ATP synthase subunit a (ATP6)?

ATP synthase subunit a (ATP6) is a critical component of the F₁F₀ ATP synthase complex located in the inner mitochondrial membrane. This protein catalyzes the late steps of ATP production via oxidative phosphorylation. In Podospora anserina, ATP6 consists of 264 amino acids with the sequence starting with MNTLFNTVNFWRYNSSPLTQFEIKDL . The protein is highly hydrophobic and serves as a membrane-embedded component that forms part of the proton channel necessary for ATP synthesis.

How does Podospora anserina ATP6 differ from ATP6 in other organisms?

P. anserina ATP6 shares structural similarities with other fungal ATP6 proteins but displays species-specific amino acid sequences. While maintaining the core functional domains necessary for ATP synthesis, P. anserina ATP6 has evolved distinct characteristics that may reflect adaptations to its ecological niche and life cycle.

A key difference in ATP synthase biology among fungi relates to the genetic encoding of its subunits. In P. anserina, research on ATP synthase subunit c (not ATP6) has revealed interesting patterns of gene transfer from mitochondria to the nucleus. Analysis of 26 fungal species showed five different Atp9 gene distributions between mitochondrial and nuclear genomes . Such variation in genetic encoding might also exist for ATP6, though this has not been explicitly documented in the available research.

How should recombinant Podospora anserina ATP6 be stored and handled for optimal stability?

Recombinant P. anserina ATP6 is typically supplied in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein's stability . For storage:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • Avoid repeated freezing and thawing cycles, which can degrade protein structure and function

  • Working aliquots can be maintained at 4°C for up to one week

  • The protein should be handled with care due to its hydrophobic nature, which makes it prone to aggregation

What are the recommended protocols for using recombinant ATP6 in functional ATP synthase assays?

When designing functional assays for recombinant P. anserina ATP6, researchers should consider the following methodological approach:

  • Reconstitution in liposomes: Due to its hydrophobic nature, ATP6 requires careful reconstitution into artificial lipid bilayers to maintain its native conformation.

  • Proton translocation assays: Measure proton movement using pH-sensitive dyes or electrodes to assess ATP6 function in the proton channel of ATP synthase.

  • Complex assembly studies: Investigate how recombinant ATP6 integrates with other ATP synthase subunits using blue native gel electrophoresis or co-immunoprecipitation.

  • ATP synthesis measurements: Quantify ATP production in reconstituted systems with luciferase-based assays.

When interpreting results, compare your findings with the well-documented studies on ATP synthase subunit c in P. anserina, where two nuclear genes (PaAtp9-5 and PaAtp9-7) display different expression profiles throughout the fungus life cycle .

How can researchers effectively use recombinant ATP6 in structural biology studies?

For structural investigations of P. anserina ATP6:

  • Sample preparation:

    • Purify the protein in detergent micelles that preserve native conformation

    • Maintain optimal buffer conditions (Tris-based buffer with glycerol as provided)

    • Consider adding stabilizing agents specific for membrane proteins

  • Structural analysis techniques:

    • Cryo-electron microscopy: Particularly suitable for membrane proteins like ATP6

    • X-ray crystallography: Requires specialized crystallization techniques for membrane proteins

    • NMR spectroscopy: For dynamic studies of specific domains

  • Interpretation challenges:

    • Account for the highly hydrophobic nature of ATP6

    • Consider the native interaction with other ATP synthase subunits

    • Compare structural data with functional assays to correlate structure with function

What are the current hypotheses regarding the regulation of ATP6 expression during different life cycle stages of Podospora anserina?

While specific data on ATP6 regulation in P. anserina is limited in the provided research, insights can be drawn from studies on ATP synthase subunit c (ATP9), which may share regulatory patterns with ATP6 as part of the same complex.

Research on subunit c has revealed that:

  • P. anserina employs two nuclear genes (PaAtp9-5 and PaAtp9-7) with dramatically different expression profiles throughout its life cycle .

  • PaAtp9-5 is strongly expressed during ascospore germination, with transcript levels approximately 1000 times higher than PaAtp9-7 in non-germinated ascospores .

  • PaAtp9-7 is predominantly expressed during sexual reproduction .

These findings suggest a sophisticated regulatory system for ATP synthase components that may extend to ATP6. It is hypothesized that P. anserina modulates ATP synthase production according to energy demands at different developmental stages. Researchers investigating ATP6 regulation should consider examining its expression patterns during:

  • Ascospore germination (high energy demand phase)

  • Vegetative growth

  • Sexual reproduction

  • Response to environmental stressors

What experimental approaches can resolve discrepancies in ATP6 functional studies across different fungal species?

Researchers encountering inconsistent results when studying ATP6 across fungal species should consider the following methodological approaches:

  • Standardized expression systems:

    • Develop consistent heterologous expression protocols

    • Ensure proper protein folding and post-translational modifications

    • Verify protein quality using multiple analytical techniques

  • Comparative functional assays:

    • Design experiments that simultaneously test ATP6 from multiple species

    • Control for differences in lipid environments that may affect function

    • Measure multiple parameters (proton translocation, ATP synthesis, complex stability)

  • Phylogenetic analysis framework:

    • Map functional differences to evolutionary relationships

    • Identify conserved vs. variable regions that may explain functional divergence

    • Consider the evolutionary history of ATP6 gene transfer between mitochondrial and nuclear genomes, as seen with ATP9

  • Data integration approach:

    • Combine structural, functional, and expression data

    • Develop mathematical models to explain species-specific differences

    • Consider the broader context of energy metabolism in different fungal lifestyles

How is ATP6 expression coordinated with other ATP synthase subunits in Podospora anserina?

The coordination of ATP synthase subunit expression involves complex regulatory mechanisms. While direct data on ATP6 coordination is limited, research on ATP synthase subunit c provides valuable insights:

Methodological approaches to investigate ATP6 coordination include:

  • RNA-seq analysis across developmental stages

  • Promoter analysis to identify shared regulatory elements

  • Chromatin immunoprecipitation to identify transcription factors

  • Metabolic labeling to measure protein synthesis rates

What role might ATP6 play in the transcriptional response of P. anserina to bacterial exposure or vegetative incompatibility?

Research on P. anserina's transcriptional responses to bacterial exposure and vegetative incompatibility (VI) may provide context for understanding ATP6 regulation under stress conditions:

  • P. anserina shows overlapping transcriptional responses to bacterial exposure and VI conditions, suggesting shared cellular pathways .

  • Genes related to autophagy, secondary metabolites, and histidine kinase signaling are up-regulated in both bacterial response and VI .

  • While specific information about ATP6 regulation in these conditions is not directly provided, genes involved in energy metabolism likely play important roles in the cellular response to stress.

Researchers investigating ATP6's role in these responses should consider:

  • Examining ATP6 expression profiles during bacterial exposure and VI

  • Analyzing the impact of ATP6 mutations on survival during bacterial challenge

  • Investigating potential roles of ATP6 in stress-induced mitochondrial remodeling

  • Exploring connections between ATP synthesis capacity and programmed cell death pathways

What are the critical quality control parameters when working with recombinant P. anserina ATP6?

Ensuring high-quality recombinant P. anserina ATP6 is essential for reliable research results. Researchers should implement the following quality control measures:

  • Purity assessment:

    • SDS-PAGE analysis: >95% purity is desirable

    • Mass spectrometry: Confirm correct molecular weight and absence of truncations

    • Western blot: Verify identity using specific antibodies

  • Structural integrity:

    • Circular dichroism: Assess secondary structure composition

    • Fluorescence spectroscopy: Monitor tertiary structure integrity

    • Dynamic light scattering: Check for aggregation

  • Functional validation:

    • Lipid binding assays: Verify membrane protein properties

    • Proton translocation assays: Confirm channel functionality

    • ATP synthase reconstitution: Test assembly with partner subunits

  • Storage condition verification:

    • Stability testing at different temperatures

    • Freeze-thaw cycle tolerance

    • Long-term activity retention

How can researchers address challenges in expressing and purifying recombinant ATP6 for structural studies?

The hydrophobic nature of ATP6 presents significant challenges for expression and purification. Researchers can overcome these challenges with the following approaches:

  • Expression systems optimization:

    • Test multiple expression hosts (E. coli, yeast, insect cells)

    • Consider cell-free expression systems for toxic membrane proteins

    • Use specialized strains with enhanced membrane protein expression capabilities

    • Optimize induction conditions (temperature, inducer concentration, timing)

  • Fusion partner strategies:

    • N-terminal fusions (MBP, SUMO, Trx) to enhance solubility

    • C-terminal purification tags that can be cleaved post-purification

    • GFP fusion for monitoring expression and folding

  • Purification refinement:

    • Screen detergent panels to identify optimal solubilization conditions

    • Consider nanodisc or amphipol technology for improved stability

    • Implement stringent chromatography protocols (affinity, ion exchange, size exclusion)

    • Develop detergent exchange protocols for structural studies

  • Yield enhancement:

    • Codon optimization for expression host

    • Chaperone co-expression

    • Directed evolution of expression constructs

    • Membrane-targeting signal sequence optimization

How does the evolutionary history of ATP6 compare to other ATP synthase subunits in fungi?

The evolutionary history of ATP synthase subunits in fungi reveals fascinating patterns of gene transfer and adaptation:

  • For ATP synthase subunit c (ATP9), analysis of 26 fungal species revealed five different gene distribution patterns between mitochondrial and nuclear genomes .

  • Phylogenetic evidence suggests that Atp9 gene evolution has included two independent transfers from mitochondria to the nucleus, followed by several independent episodes of gene loss .

  • While specific evolutionary data for ATP6 is not provided in the search results, it may follow similar evolutionary patterns of gene transfer between organellar and nuclear genomes.

To investigate ATP6 evolution, researchers should:

  • Conduct phylogenetic analyses across diverse fungal species

  • Compare mitochondrial and nuclear genome sequences to identify potential gene transfers

  • Examine synteny of ATP6 genes in related species

  • Analyze selection patterns to identify functionally important residues

What methodological approaches can determine if P. anserina ATP6 undergoes post-translational modifications that affect function?

Post-translational modifications (PTMs) can significantly impact ATP6 function. Researchers can employ the following methods to identify and characterize PTMs:

  • Mass spectrometry-based approaches:

    • Bottom-up proteomics: Enzymatic digestion followed by LC-MS/MS

    • Top-down proteomics: Analysis of intact protein

    • Targeted MS: Focus on specific modification sites

    • Quantitative proteomics: Compare modification levels under different conditions

  • Site-specific analysis:

    • Site-directed mutagenesis of potential modification sites

    • Phospho-specific or other modification-specific antibodies

    • Chemical labeling of modified residues

  • Functional correlation:

    • Activity assays comparing native and demodified protein

    • Structural studies to visualize modification sites

    • In vitro modification systems to study modification kinetics

  • Physiological relevance:

    • Mutational studies in living P. anserina

    • Analysis of modification patterns during different life cycle stages

    • Correlation with energy demands and stress responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.