Recombinant Podospora anserina Bifunctional lycopene cyclase/phytoene synthase

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be defined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Pa_1_15240; PODANS_1_15240; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-593
Protein Length
full length protein
Species
Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina)
Target Names
Pa_1_15240
Target Protein Sequence
MAYDYALVHLKYTIPLAALLTVIAYPIFHRIHFLQIGSLIVVSFLATLPWDSYLIRSNIW TYPPDAIIGPRLYGIPIEELFFFVIQTYITSLFYILLSKPLFHPLYLSTQRNPPQRIARG KVIGQGILVALTLYGVHQIRTGGPGTYLGLILAWAFPFALLTFTVAGRFILTLPLTSTVV PIIIPTVYLWLVDELALGRGTWAIESGTKLGWCLFGVLDIEEATFFLATNILIVFGMAVF DQYLAIIFAFPHLFPKVPRSPTPLMLVQSRFSNTKQYDLERIAGLSDAVTRLKAKSRSFY LANSLFTGRLRIDLILLYSFCRLADDLVDDSTSRTEVKSWTTKLYKFLDLHYKSDVKANK ARINDYIDEAFPPEAKSALKYLPATILPSQPLYQLIEGFELDSQFSFHDSSESAKYPIVD EDKLNYYGQCVAGTVGELCVALIIEHCEPEMPDERKKMLMSVSRTMGVALQYVNIARDIV VDAEMGRVYLPTTWLKEEGLTPEDVVAHPRGKHVENLRRRLLSEAFKLYDEARPKMNGIP KEARGPMIGAVETYMEIGRVLRELEGGVELERGKATVPGGRRLKTVLKALFSA
Uniprot No.

Target Background

Function
This bifunctional enzyme catalyzes the reactions from geranylgeranyl diphosphate to phytoene (phytoene synthase) and lycopene to beta-carotene via the intermediate gamma-carotene (lycopene cyclase).
Database Links
Protein Families
Lycopene beta-cyclase family; Phytoene/squalene synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the bifunctional lycopene cyclase/phytoene synthase from Podospora anserina?

The bifunctional lycopene cyclase/phytoene synthase from P. anserina is a dual-function enzyme encoded by the al-2 gene that catalyzes two distinct reactions in the carotenoid biosynthetic pathway. As a phytoene synthase (EC 2.5.1.32), it condenses two molecules of geranylgeranyl pyrophosphate to form phytoene, and as a lycopene cyclase (EC 5.5.1.19), it cyclizes the ends of the linear lycopene molecule to form cyclic carotenoids . This enzyme represents an interesting case of evolutionary fusion of two enzymatic activities into a single polypeptide of 593 amino acids .

How does the bifunctional enzyme compare to similar enzymes in other fungi?

The P. anserina bifunctional lycopene cyclase/phytoene synthase corresponds functionally to the al-2 gene product from Neurospora crassa . While many organisms have separate genes encoding these two activities, the fusion of both functions into a single polypeptide appears to be a conserved feature in certain fungal lineages. Comparative analysis shows the enzyme maintains high structural conservation across the Sordariales order while exhibiting species-specific adaptations . The gene's conservation across species suggests essential functions potentially beyond carotenoid biosynthesis, as evidenced by its involvement in extending the organism's lifespan when overexpressed .

What is the role of this enzyme in the carotenoid biosynthetic pathway of P. anserina?

In the carotenoid biosynthetic pathway of P. anserina, this bifunctional enzyme catalyzes two critical steps:

  • Phytoene Synthesis: Condenses two geranylgeranyl pyrophosphate molecules to form phytoene (the first committed step in carotenoid biosynthesis)

  • Lycopene Cyclization: Converts the linear carotenoid lycopene into cyclic carotenoids such as beta-zeacarotene and 7,8-dihydro-beta-carotene

These reactions represent key branch points in the parallel pathway leading to neurosporene and beta-carotene production in P. anserina . The enzyme works in conjunction with products of al-1 and al-3 genes to complete the beta-carotene biosynthetic branch .

What is known about the three-dimensional structure of this bifunctional enzyme?

The three-dimensional structure of the P. anserina bifunctional lycopene cyclase/phytoene synthase has been computationally modeled using AlphaFold with high confidence (pLDDT global score of 92.04) . This model reveals a complex arrangement of domains that accommodate the dual catalytic functions. While no experimental structure (X-ray crystallography or NMR) has been published, the computational model provides valuable insights into domain organization and potential catalytic sites . The high confidence score suggests the model closely approximates the actual protein structure, particularly in the core domains responsible for the enzymatic activities.

What are the key structural domains and how do they relate to the dual functionality?

The bifunctional lycopene cyclase/phytoene synthase from P. anserina contains distinct structural domains that enable its dual functionality:

  • Phytoene Synthase Domain: Contains the active site for the condensation of geranylgeranyl pyrophosphate molecules

  • Lycopene Cyclase Domain: Contains the catalytic machinery for cyclizing the ends of linear carotenoids

These domains likely evolved through gene fusion events, allowing for coordinated regulation of two sequential steps in carotenoid biosynthesis . Structural predictions suggest potential substrate binding sites and catalytic residues that are highly conserved across fungal species . The enzyme's structure reflects its adaptation to perform two mechanistically distinct reactions within a single polypeptide.

How can researchers analyze conformational changes during catalysis?

Analyzing conformational changes during catalysis for this bifunctional enzyme requires multiple complementary approaches:

  • Molecular Dynamics Simulations: Using the AlphaFold predicted structure (UniProt ID: B2ATB0) as a starting point, researchers can perform extensive MD simulations to model domain movements during substrate binding and catalysis

  • Site-Directed Mutagenesis: Systematic mutation of predicted hinge regions or catalytic residues can help identify key structural elements involved in conformational changes during the catalytic cycle

  • FRET-Based Approaches: Engineering fluorescent tags at strategic positions can enable real-time monitoring of domain movements using Förster Resonance Energy Transfer techniques

  • HDX-MS Analysis: Hydrogen-deuterium exchange mass spectrometry can identify regions with altered solvent accessibility during catalysis, revealing conformational dynamics

  • Cryo-EM: While technically challenging for enzymes of this size (593 amino acids), cryo-electron microscopy could potentially capture different conformational states during the catalytic cycle

These approaches should be integrated with enzymatic activity assays to correlate structural changes with specific catalytic functions.

What expression systems are most suitable for producing recombinant P. anserina bifunctional lycopene cyclase/phytoene synthase?

Based on published methodologies for similar enzymes and standard practices for fungal proteins, the following expression systems are recommended for recombinant production of this bifunctional enzyme:

  • Escherichia coli Systems:

    • BL21(DE3) strains with pET-based vectors for high-level expression

    • Arctic Express or Rosetta strains for improved folding of this eukaryotic protein

    • Co-expression with molecular chaperones to enhance solubility

  • Yeast Expression Systems:

    • Pichia pastoris (Komagataella phaffitatis) for secreted expression under AOX1 promoter

    • Saccharomyces cerevisiae for expression with native-like post-translational modifications

  • Fungal Expression Systems:

    • Homologous expression in P. anserina itself, leveraging techniques used in the original studies

    • Neurospora crassa expression systems, given the homology between al-2 genes

For functional studies, the homologous expression in P. anserina has proven successful, allowing for up to eightfold increased carotenoid synthesis . For structural studies requiring larger protein quantities, heterologous expression in E. coli or yeast systems may be preferable after codon optimization.

What purification challenges are specific to this bifunctional enzyme, and how can they be addressed?

Purification of the bifunctional lycopene cyclase/phytoene synthase presents several challenges due to its dual functionality and membrane association properties:

Common Challenges and Solutions:

  • Limited Solubility:

    • Use mild detergents (0.5-1% Triton X-100 or n-dodecyl-β-D-maltoside)

    • Include 10-15% glycerol in all buffers to improve stability

    • Optimize ionic strength (typically 150-300 mM NaCl) to prevent aggregation

  • Maintaining Dual Activity:

    • Include both phytoene synthase and lycopene cyclase activity assays at each purification step

    • Supplement buffers with divalent cations (Mg²⁺, Mn²⁺) required for catalytic activity

    • Maintain reducing conditions (1-5 mM DTT or β-mercaptoethanol) to protect active site cysteines

  • Specific Purification Protocol:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

    • Intermediate purification: Ion exchange chromatography (typically Q-Sepharose)

    • Polishing step: Size exclusion chromatography in buffers containing stabilizing agents

  • Activity Preservation:

    • Minimize freeze-thaw cycles by flash-freezing small aliquots in liquid nitrogen

    • Store at -80°C in buffer containing 20% glycerol and reducing agents

    • Include protease inhibitors throughout purification to prevent degradation

These strategies should be optimized based on the specific expression system chosen and the intended downstream applications of the purified enzyme .

How can researchers accurately measure the dual enzymatic activities of this bifunctional enzyme?

Accurate measurement of both phytoene synthase and lycopene cyclase activities requires distinct assay approaches:

Phytoene Synthase Activity (EC 2.5.1.32):

  • Radiochemical Assay:

    • Substrate: ¹⁴C-labeled geranylgeranyl pyrophosphate

    • Reaction conditions: 100 mM Tris-HCl pH 7.4, 5 mM MgCl₂, 1 mM DTT, 30°C

    • Detection: Extraction with organic solvent and thin-layer chromatography followed by autoradiography

    • Quantification: Scintillation counting of extracted products

  • HPLC-Based Assay:

    • Substrate: Unlabeled geranylgeranyl pyrophosphate

    • Reaction conditions: Similar to radiochemical assay

    • Detection: Reverse-phase HPLC with C30 column and UV detection at 287 nm (phytoene absorption maximum)

    • Quantification: Peak area integration with phytoene standards

Lycopene Cyclase Activity (EC 5.5.1.19):

  • Spectrophotometric Assay:

    • Substrate: Lycopene (requires separate preparation)

    • Reaction conditions: 100 mM HEPES pH 8.0, 0.1% Triton X-100, 5 mM NADPH, 30°C

    • Detection: Measurement of absorbance change at 460-470 nm (lycopene) and 425-450 nm (β-carotene)

    • Quantification: Calculation using extinction coefficients of substrates and products

  • HPLC-Based Assay:

    • Substrate: Lycopene

    • Reaction conditions: Similar to spectrophotometric assay

    • Detection: Reverse-phase HPLC with C30 column and photodiode array detection

    • Quantification: Peak area integration with standards for cyclic carotenoids (β-zeacarotene and 7,8-dihydro-β-carotene)

For comprehensive characterization, researchers should determine standard enzyme kinetic parameters (Km, Vmax, kcat) for each activity and investigate potential regulatory interactions between the two catalytic functions .

What genetic manipulation approaches have been successful for studying this enzyme in P. anserina?

Several genetic manipulation approaches have proven successful for studying the bifunctional lycopene cyclase/phytoene synthase in P. anserina:

  • Overexpression Studies:

    • The al-2 gene has been successfully overexpressed in P. anserina using fungal expression vectors

    • This approach led to up to eightfold increased carotenoid synthesis and 31% prolonged lifespan of the mycelium

    • Specific vectors containing strong constitutive promoters (e.g., gpd promoter) or inducible promoters have been employed

  • Combinatorial Expression:

    • Co-expression of al-2 with other carotenoid biosynthetic genes (al-1, al-3) has been performed

    • This approach allows for manipulation of the entire carotenoid pathway and accumulation of specific intermediates

    • Analysis of these transformants revealed accumulation of β-zeacarotene and 7,8-dihydro-β-carotene

  • Site-Directed Mutagenesis:

    • Targeted mutations in catalytic domains to separately study each enzymatic function

    • Creation of domain-specific mutants to investigate structure-function relationships

    • Analysis of these mutants helps elucidate the mechanistic basis of the dual functionality

  • Gene Deletion/Complementation:

    • Knockout of the native gene followed by complementation with wild-type or mutant versions

    • This approach allows for detailed phenotypic analysis of specific enzyme functions in vivo

  • Reporter Gene Fusions:

    • Creation of al-2 promoter-reporter gene fusions to study transcriptional regulation

    • Fusion of fluorescent tags to study subcellular localization and protein interactions

These genetic approaches have provided valuable insights into both the biochemical functions of the enzyme and its physiological roles, particularly in aging and stress responses .

How does overexpression of this enzyme affect carotenoid profiles and lifespan in P. anserina?

Overexpression of the bifunctional lycopene cyclase/phytoene synthase in P. anserina leads to significant changes in both carotenoid profiles and organism lifespan:

Carotenoid Profile Changes:

  • Quantitative Increase:

    • Up to eightfold increase in total carotenoid content

    • Enhanced accumulation of pathway intermediates

  • Qualitative Changes:

    • Accumulation of specific cyclic carotenoids, particularly β-zeacarotene and 7,8-dihydro-β-carotene

    • Altered ratios of neurosporene to β-carotene

  • Pathway Shifts:

    • Enhanced flux through the β-carotene branch of the carotenoid pathway

    • Changes in the relative abundance of different carotenoid species

Lifespan Effects:

  • Extended Longevity:

    • Up to 31% prolonged life span of the mycelium in transformants with overexpressed al-2 gene

    • This effect appears specific to the al-2 gene, as overexpression of other carotenoid biosynthetic genes did not produce comparable lifespan extension

  • Potential Mechanisms:

    • Increased antioxidant capacity due to higher carotenoid levels

    • Specific effects of cyclic carotenoids (β-zeacarotene and 7,8-dihydro-β-carotene) on cellular processes

    • Possible interaction with known aging pathways in P. anserina

These findings suggest a potential role for carotenoids, particularly those produced via the lycopene cyclase activity, in modulating aging processes in filamentous fungi . The specific molecular mechanisms underlying this lifespan extension remain an active area of research.

Table 1: Effects of al-2 Gene Overexpression in P. anserina

ParameterWild-typeal-2 OverexpressionChange
Total carotenoid contentBaselineUp to 8-fold increase+700%
LifespanBaselineUp to 31% increase+31%
β-zeacaroteneLow levelsSignificant accumulation+++
7,8-dihydro-β-caroteneLow levelsSignificant accumulation+++
Pathway flux to β-caroteneNormalEnhanced++

How can structural knowledge of this bifunctional enzyme inform protein engineering efforts?

Structural knowledge of the bifunctional lycopene cyclase/phytoene synthase can guide sophisticated protein engineering through several strategic approaches:

  • Domain Interface Engineering:

    • The high-confidence AlphaFold model (pLDDT: 92.04) reveals domain interfaces that can be modified to alter communication between catalytic centers

    • Strategic mutations at these interfaces could enhance substrate channeling between the two active sites

    • Introduction of flexible linkers between domains may optimize conformational dynamics for both activities

  • Active Site Optimization:

    • Precise mapping of catalytic residues for each function enables targeted mutations to alter substrate specificity

    • Modification of binding pockets could accommodate non-native substrates for novel carotenoid biosynthesis

    • Saturation mutagenesis of key catalytic regions can generate variants with enhanced activity or altered product profiles

  • Stability Enhancement:

    • Computational analysis of the structure can identify regions prone to unfolding or aggregation

    • Introduction of disulfide bonds or salt bridges at strategic positions can enhance thermostability

    • Surface charge optimization can improve solubility while maintaining dual functionality

  • Creation of Mono-functional Variants:

    • Structure-guided truncation to generate separate phytoene synthase and lycopene cyclase enzymes

    • These mono-functional variants would serve as valuable tools for dissecting the contribution of each activity to lifespan extension

    • Comparison of separated versus fused activities could reveal evolutionary advantages of the bifunctional arrangement

  • Biosensor Development:

    • Engineering allosteric sites that trigger conformational changes detectable via reporter systems

    • These engineered variants could serve as biosensors for metabolic intermediates or cellular conditions

Leveraging the structural information from the AlphaFold model together with experimental validation through activity assays provides a powerful foundation for rational engineering of this bifunctional enzyme for both fundamental research and biotechnological applications.

What is the evolutionary significance of the dual functionality in this enzyme?

The evolutionary significance of dual functionality in the lycopene cyclase/phytoene synthase enzyme presents a fascinating case study in enzyme evolution:

  • Functional Coupling Advantages:

    • The fusion of sequential enzymatic activities likely provides kinetic advantages through substrate channeling

    • Direct transfer of intermediates between active sites potentially prevents loss of unstable intermediates

    • This arrangement may protect reactive intermediates from oxidative damage or competing reactions

  • Phylogenetic Analyses:

    • Comparative genomics across fungi reveals that this gene fusion is conserved in Sordariales, including P. anserina and N. crassa

    • The conservation pattern suggests the fusion occurred early in fungal evolution and has been maintained by selective pressure

    • Similar to other genomic features in P. anserina, this fusion may exhibit trans-species polymorphism, as observed with the het-B locus

  • Coordinated Regulation:

    • The fusion enables simultaneous transcriptional and translational regulation of two sequential pathway steps

    • This coordination may be particularly advantageous for stress-responsive pathways like carotenoid biosynthesis

    • The stoichiometric production of both enzymatic activities prevents metabolic bottlenecks

  • Metabolic Implications:

    • The bifunctional nature may facilitate metabolic channeling, improving pathway efficiency

    • This arrangement potentially allows for feedback regulation mechanisms spanning both activities

    • The fusion may represent an evolutionary solution to optimize resource allocation during carotenoid biosynthesis

The dual functionality likely contributes to the observed lifespan extension effects , suggesting that the evolutionary conservation of this fusion may be tied to its role in stress resistance and aging processes in filamentous fungi.

How might this enzyme's dual functionality be exploited for synthetic biology applications?

The dual functionality of P. anserina bifunctional lycopene cyclase/phytoene synthase offers several promising opportunities for synthetic biology applications:

  • Streamlined Carotenoid Pathway Engineering:

    • Expression of this single bifunctional enzyme can replace two separate enzymes in engineered carotenoid pathways

    • This simplifies genetic constructs and potentially improves pathway efficiency through substrate channeling

    • Heterologous expression in bacteria, yeast, or plants could enhance carotenoid production

  • Designer Carotenoid Biosynthesis:

    • Structure-guided mutagenesis could alter substrate specificity or product profiles

    • Engineering variants that produce novel cyclic carotenoids with enhanced bioactivities

    • Creation of synthetic pathways that generate non-natural carotenoids with industrial applications

  • Anti-Aging Applications:

    • Given the lifespan extension effect in P. anserina (up to 31%) , this enzyme could be exploited in other systems

    • Expression in model organisms could test conservation of anti-aging effects across species

    • Investigation of specific carotenoid products (β-zeacarotene and 7,8-dihydro-β-carotene) as potential anti-aging compounds

  • Metabolic Switch Devices:

    • Engineering allosteric regulation into the bifunctional enzyme to create metabolic switches

    • Development of sensors that redirect carbon flux between different carotenoid branches in response to specific signals

    • Creation of genetic circuits that utilize the dual functionality for complex metabolic programming

  • Combinatorial Biosynthesis Platforms:

    • Using the bifunctional enzyme as a core module in combinatorial biosynthesis systems

    • Pairing with other modified enzymes to create diverse carotenoid libraries

    • High-throughput screening of these libraries for compounds with novel properties

These applications would benefit from the detailed structural information provided by the AlphaFold model and could build upon the established genetic manipulation techniques that have already proven successful in P. anserina .

What are common technical challenges when studying this bifunctional enzyme, and how can they be addressed?

Researchers studying the P. anserina bifunctional lycopene cyclase/phytoene synthase frequently encounter several technical challenges:

  • Enzyme Stability Issues:

    • Challenge: Rapid loss of activity during purification and storage

    • Solution: Include stabilizing agents (10-20% glycerol, 1 mM DTT) in all buffers; purify at 4°C with minimal handling; consider adding specific lipids that may be required for stability

  • Assay Interference Problems:

    • Challenge: Carotenoid extraction and quantification complicated by cellular components

    • Solution: Develop selective extraction protocols using appropriate organic solvents; implement internal standards for quantification; use HPLC methods with photodiode array detection for accurate product identification

  • Heterologous Expression Difficulties:

    • Challenge: Poor expression or inclusion body formation in E. coli systems

    • Solution: Optimize codon usage; lower induction temperature (16-20°C); co-express with chaperones; consider fungal expression systems closer to the native context

  • Activity Reconstitution:

    • Challenge: Difficulty reconstituting full activity in vitro after purification

    • Solution: Test various membrane mimetics (nanodiscs, liposomes); optimize detergent type and concentration; include potential cofactors in reaction mixtures

  • Structural Analysis Complications:

    • Challenge: Obtaining structural data beyond computational predictions

    • Solution: Use limited proteolysis to identify domain boundaries; consider crystallizing individual domains if the full-length protein proves recalcitrant; employ hydrogen-deuterium exchange mass spectrometry for dynamic structural information

  • Phenotypic Analysis in vivo:

    • Challenge: Distinguishing direct effects of enzyme modulation from secondary metabolic changes

    • Solution: Implement tight inducible expression systems; create catalytically inactive mutants as controls; perform metabolomic profiling to capture broader effects

These methodological approaches have been developed through experience with similar bifunctional enzymes and standard practices in enzyme biochemistry .

How can researchers overcome challenges in measuring the separate activities of this bifunctional enzyme?

Accurately measuring the separate activities of the bifunctional lycopene cyclase/phytoene synthase presents unique challenges that can be addressed through strategic experimental design:

  • Substrate Availability Challenges:

    • Problem: Limited commercial availability of substrates (geranylgeranyl pyrophosphate, lycopene)

    • Solution: Enzymatic synthesis of GGPP using commercially available farnesyl pyrophosphate and GGPP synthase; extraction and purification of lycopene from producing organisms or development of chemical synthesis routes

  • Sequential Activity Interference:

    • Problem: Products of phytoene synthase activity may immediately become substrates for lycopene cyclase activity

    • Solution: Design specific reaction conditions that favor one activity over the other (pH, temperature, cofactor composition); utilize substrate analogs that are accepted by only one active site; perform coupled assays with auxiliary enzymes

  • Domain-Specific Inhibition:

    • Problem: Difficulty isolating individual activities for measurement

    • Solution: Identify domain-specific inhibitors through computational docking and experimental validation; create point mutations that selectively inactivate one domain while preserving the other; develop antibodies that specifically block access to one active site

  • Kinetic Analysis Complications:

    • Problem: Complex kinetics due to potential interactions between domains

    • Solution: Develop comprehensive kinetic models that account for potential substrate channeling; perform product inhibition studies to reveal interdomain communication; utilize pre-steady-state kinetics to isolate individual steps

  • Practical Workflow for Separate Activity Measurements:

    For Phytoene Synthase Activity:

    • Use reaction conditions that minimize cyclase activity (lower pH, absence of NADPH)

    • Add inhibitors specific to the cyclase domain if available

    • Use substrate analogs that are not accepted by the cyclase domain

    • Conduct assays over short time periods to minimize sequential activity

    For Lycopene Cyclase Activity:

    • Supply purified lycopene as substrate (bypassing the need for phytoene synthase activity)

    • Include NADPH as a cofactor (required for cyclase but not synthase activity)

    • Optimize pH conditions favoring cyclase activity (typically higher pH)

    • Use selective detection methods specific for cyclic carotenoids

What experimental controls are critical when studying the effects of this enzyme on P. anserina lifespan?

  • Genetic Background Controls:

    • Empty vector controls: Transformants containing the same expression vector without the al-2 gene to account for transformation-related effects

    • Isogenic strain comparisons: Use of the same genetic background for all experiments to minimize strain-specific variations

    • Multiple independent transformants: Analysis of several transformant lines to control for positional effects of integration

  • Expression Controls:

    • Quantification of enzyme levels: Western blot or qRT-PCR verification of expression levels across experimental groups

    • Inducible expression systems: Use of controllable promoters to establish dose-dependent relationships

    • Catalytically inactive mutants: Expression of mutated versions lacking one or both enzymatic activities to distinguish activity-dependent from protein-dependent effects

  • Metabolic Analysis Controls:

    • Carotenoid profiling: Comprehensive analysis of carotenoid content to correlate specific compounds with lifespan effects

    • Pathway inhibition: Use of specific inhibitors of carotenoid biosynthesis to confirm causality

    • Supplementation studies: Direct administration of purified carotenoids to determine if they recapitulate lifespan extension

  • Lifespan Measurement Controls:

    • Standardized culture conditions: Consistent medium composition, temperature, and humidity

    • Blinded analysis: Unbiased assessment of lifespan endpoints by researchers unaware of sample identity

    • Statistical power: Sufficient biological replicates (typically n≥30 per condition) for robust statistical analysis

    • Alternative markers of aging: Assessment of multiple aging parameters beyond chronological lifespan

  • Environmental Controls:

    • Light exposure standardization: Controlled light conditions to account for potential photoregulation of carotenoid synthesis

    • Oxidative stress conditions: Testing under both normal and oxidative stress conditions to assess stress resistance contributions

    • Nutrient availability: Consistent carbon and nitrogen sources across experiments

These controls help distinguish direct effects of enzyme overexpression from indirect consequences or experimental artifacts, ensuring that the reported lifespan extension (up to 31%) can be reliably attributed to the activities of the bifunctional enzyme or its carotenoid products .

What are the most promising unexplored aspects of this bifunctional enzyme?

Several high-potential research directions remain largely unexplored for the P. anserina bifunctional lycopene cyclase/phytoene synthase:

  • Structural Dynamics During Catalysis:

    • Investigation of conformational changes during the catalytic cycle using advanced biophysical methods

    • Elucidation of potential substrate channeling mechanisms between the two catalytic domains

    • Determination of how substrate binding to one domain influences the activity of the other

  • Regulatory Mechanisms:

    • Identification of post-translational modifications that regulate enzyme activity

    • Characterization of potential protein-protein interactions that modulate function

    • Investigation of feedback regulation by pathway intermediates or end products

  • Connection to Aging Pathways:

    • Molecular mechanism linking enzyme overexpression to the observed 31% lifespan extension

    • Interaction with known longevity pathways (e.g., mitochondrial function, ROS signaling)

    • Identification of specific carotenoid species responsible for lifespan effects

  • Evolutionary Origins:

    • Detailed phylogenetic analysis of the gene fusion event creating this bifunctional enzyme

    • Comparative studies across fungal species to understand selective pressures maintaining the fusion

    • Investigation of potential horizontal gene transfer events in the evolution of carotenoid biosynthesis

  • Biotechnological Applications:

    • Development of enzyme variants with altered product profiles for novel carotenoid production

    • Exploration of potential applications in anti-aging research based on the lifespan extension effects

    • Investigation of medical applications of specific cyclic carotenoids (β-zeacarotene and 7,8-dihydro-β-carotene)

These research directions could significantly advance our understanding of enzyme evolution, carotenoid biochemistry, and the molecular mechanisms of aging while potentially yielding valuable biotechnological applications.

How might CRISPR-Cas9 approaches be applied to study this enzyme in P. anserina?

CRISPR-Cas9 technology offers powerful new approaches for studying the bifunctional lycopene cyclase/phytoene synthase in P. anserina:

  • Precise Genome Editing Applications:

    • Domain-specific mutations: Introduction of point mutations to selectively disrupt either phytoene synthase or lycopene cyclase activity while preserving the other

    • Promoter engineering: Modification of the native promoter to create conditional expression systems

    • Tagged variants: Insertion of epitope or fluorescent tags for tracking protein localization and interactions

    • Regulatory element analysis: Systematic deletion or mutation of putative regulatory regions

  • Advanced Screening Approaches:

    • CRISPR interference (CRISPRi): Targeted repression of gene expression using catalytically inactive Cas9

    • CRISPR activation (CRISPRa): Upregulation of gene expression using modified Cas9 systems fused to transcriptional activators

    • Multiplex editing: Simultaneous modification of multiple genes in the carotenoid pathway to redirect flux

  • Functional Genomics Strategies:

    • Saturating mutagenesis: Creation of comprehensive mutant libraries to map structure-function relationships

    • Base editing: Precise C→T or A→G substitutions without double-strand breaks for subtle functional alterations

    • Prime editing: Introduction of specific insertions, deletions, or all possible point mutations with minimal off-target effects

  • Implementation Protocol Outline:

    • Design and validation of sgRNAs targeting specific regions of the al-2 gene

    • Optimization of Cas9 delivery and expression in P. anserina

    • Selection of appropriate repair templates for homology-directed repair

    • Screening and verification of edited strains using sequencing and activity assays

    • Phenotypic characterization focusing on carotenoid profiles and lifespan effects

These CRISPR-based approaches would complement traditional genetic techniques and enable previously challenging experiments, such as precise domain swapping or single amino acid substitutions in the native genomic context.

What interdisciplinary approaches might yield new insights into the relationship between this enzyme, carotenoid production, and lifespan extension?

Interdisciplinary approaches combining multiple scientific disciplines could provide breakthrough insights into the relationship between the bifunctional lycopene cyclase/phytoene synthase, carotenoid production, and lifespan extension:

  • Systems Biology Integration:

    • Multi-omics profiling (transcriptomics, proteomics, metabolomics) of wild-type and al-2 overexpression strains

    • Network analysis to identify regulatory connections between carotenoid metabolism and aging pathways

    • Computational modeling of metabolic flux to predict optimal intervention points for lifespan extension

  • Structural Biology and Biophysics:

    • Cryo-EM studies of the enzyme in different functional states

    • Single-molecule FRET analysis to monitor conformational dynamics during catalysis

    • Hydrogen-deuterium exchange mass spectrometry to map structural dynamics in solution

  • Comparative Aging Biology:

    • Testing effects of the bifunctional enzyme or specific carotenoids in established aging model organisms (C. elegans, D. melanogaster)

    • Comparative analysis across multiple fungal species with different natural lifespans

    • Evaluation of enzyme variants in mammalian cell senescence models

  • Advanced Imaging Approaches:

    • Super-resolution microscopy to track carotenoid localization in aging cells

    • Label-free Raman microscopy to visualize carotenoid distribution without disrupting native chemistry

    • Correlative light and electron microscopy to connect carotenoid localization with ultrastructural features

  • Synthetic Biology Redesign:

    • Creation of orthogonal carotenoid pathways with controllable outputs

    • Optogenetic regulation of enzyme activity to enable precise temporal control

    • Design of genetic circuits linking carotenoid production to aging biomarkers

  • Translational Research:

    • Testing isolated carotenoids (β-zeacarotene and 7,8-dihydro-β-carotene) in cellular models of age-related diseases

    • Development of carotenoid-inspired small molecules with enhanced stability or bioavailability

    • Investigation of potential hormetic effects of specific carotenoids on cellular stress responses

These interdisciplinary approaches would help establish causal mechanisms connecting enzyme activity to lifespan extension and potentially identify novel intervention strategies for promoting healthy aging in various biological systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.