Recombinant Podospora anserina Golgi apparatus membrane protein TVP23 (TVP23)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Podospora anserina Golgi Apparatus Membrane Protein TVP23 (TVP23)

Recombinant Podospora anserina Golgi apparatus membrane protein TVP23 (TVP23) is a bioengineered protein derived from the ascomycete fungus P. anserina, a model organism for studying fungal biology, aging, and cellular processes. This protein is expressed in E. coli and purified for research applications, including structural studies, antibody development, and functional analyses of Golgi-mediated pathways.

Expression and Purification

TVP23 is produced via recombinant DNA technology in E. coli, with the following workflow:

  1. Cloning: The TVP23 gene is inserted into an expression vector.

  2. Induction: Protein expression is triggered under optimized conditions.

  3. Purification: Affinity chromatography (via His-tag) and lyophilization yield a stable powder .

Research Applications

ApplicationDescription
Antibody DevelopmentELISA kits (e.g., CSB-CF463884EXJ) detect TVP23-specific antibodies .
Structural StudiesX-ray crystallography or cryo-EM to map Golgi membrane interactions.
Functional AssaysInvestigating roles in protein trafficking, glycosylation, or fungal development.

Comparative Analysis with Homologs

SpeciesAA LengthKey Features
P. anserina1–191His-tagged, lyophilized; used in ELISA assays .
Phaeosphaeria nodorum1–194Similar His-tagged construct; expressed in E. coli .
Coccidioides immitis1–188Shorter C-terminal domain; potential pathogenicity-related functions .

Experimental Considerations

  • Storage: Lyophilized protein should be stored at -20°C/-80°C; avoid repeated freeze-thaw cycles .

  • Reconstitution: Dissolve in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term stability .

  • Purity: SDS-PAGE confirms >90% purity, critical for downstream applications .

Challenges and Future Directions

  • Functional Gaps: Limited data on TVP23’s interaction partners or substrates in P. anserina.

  • Evolutionary Context: Phylogenetic studies could clarify its role in fungal adaptation .

  • Therapeutic Potential: Exploring TVP23 as a target for antifungal agents or biotechnological tools.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TVP23; Pa_1_13630; PODANS_1_13630; Golgi apparatus membrane protein TVP23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina)
Target Names
TVP23
Target Protein Sequence
MEQPQPAPGSLSWRLSSHPITLLTFLGFRVSSLLVYLFGLLFTDNLVMIFIITILLLAAD FYYLKNIAGRRLVGLRWWNEVDPSTGDSHWVFESSEPGSKVINATDSRFFWIAIYAQPLF WIALAVVAVFSFKFIWLPLVAIALVLTITNSLAFSRCDKFSQASNIAGSAFNGGNLAGSI ASNMVGRFFTR
Uniprot No.

Target Background

Function
Golgi membrane protein involved in vesicular trafficking.
Database Links
Protein Families
TVP23 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

How does TVP23 fit into the broader context of Podospora anserina biology?

Podospora anserina is characterized by a limited life span, with all wild strains displaying various symptoms of senescence after prolonged vegetative growth . While the specific role of TVP23 in this process is not directly established, as a Golgi apparatus membrane protein, it likely contributes to the secretory pathway and vesicular trafficking.

The genome of P. anserina is approximately 35 Mbp arranged in seven chromosomes, with high conservation across the Podospora species complex . This conservation suggests that membrane proteins like TVP23 may serve fundamental cellular functions that have been maintained throughout the evolution of these closely related species.

What expression and purification methods are recommended for obtaining functional TVP23?

For recombinant expression of TVP23, the following methodological approach is recommended:

  • Expression system selection: While bacterial systems (E. coli) are commonly used, eukaryotic expression systems like yeast (S. cerevisiae or P. pastoris) may provide better folding conditions for this membrane protein.

  • Purification strategy:

    • Initial solubilization with mild detergents (e.g., n-dodecyl β-D-maltoside)

    • Affinity chromatography using the tag determined during production

    • Buffer optimization containing Tris with 50% glycerol for stability

  • Storage considerations: Store at -20°C for standard use or -80°C for extended storage. Prepare working aliquots at 4°C for up to one week. Avoid repeated freeze-thaw cycles .

How might TVP23 contribute to the senescence mechanisms observed in Podospora anserina?

Podospora anserina has become a model for studying senescence, with evidence showing that gross reorganizations of mitochondrial DNA occur during this process, leading to impairment of the energy-generating system . While TVP23's specific role in senescence is not directly established in the search results, methodological approaches to investigate this connection could include:

  • Comparative expression analysis: Quantify TVP23 expression levels across different ages of P. anserina cultures using RT-qPCR or proteomics.

  • Genetic modification strategies: Generate TVP23 knockout or overexpression strains using established transformation protocols for P. anserina .

  • Interaction studies: Investigate potential interactions between TVP23 and components of the mitochondrial-nuclear communication pathways implicated in senescence.

  • Subcellular localization analysis: Track potential changes in TVP23 localization during the aging process using fluorescent protein fusions and confocal microscopy.

The long-lived mutant grisea could serve as a comparison model, as it shows altered mitochondrial DNA rearrangements compared to wild-type strains .

What experimental approaches would be most effective for characterizing TVP23's interactome in Podospora anserina?

To effectively characterize the interactome of TVP23, researchers should consider the following methodological approaches:

  • Proximity-dependent biotin labeling (BioID or APEX2): Fuse TVP23 with a biotin ligase to identify proteins in close proximity within the native cellular environment.

  • Co-immunoprecipitation coupled with mass spectrometry: Using antibodies against tagged TVP23 to pull down interaction partners.

  • Yeast two-hybrid screening: While this has limitations for membrane proteins, modified split-ubiquitin systems can be effective.

  • Fluorescence resonance energy transfer (FRET): To confirm direct protein-protein interactions in living cells.

  • Genetic interaction screens: Create double mutants with TVP23 and other candidate genes to identify functional relationships.

The results should be validated across multiple experimental approaches and compared with interactome data from homologous proteins in related fungal species.

How can researchers investigate the evolutionary conservation and divergence of TVP23 across the Podospora species complex?

The Podospora species complex consists of seven closely related species with highly conserved genomes that are less than 2% divergent from each other in genic regions . To investigate TVP23 evolution across this complex, researchers should:

  • Comparative sequence analysis: Align TVP23 sequences from all seven species to identify conserved domains and species-specific variations.

  • Positive selection analysis: Calculate dN/dS ratios to identify regions under selective pressure.

  • Structural modeling: Generate protein structure predictions to visualize how sequence variations might affect protein function.

  • Functional complementation experiments: Express TVP23 from different Podospora species in a TVP23 knockout strain to test functional conservation.

  • Phylogenetic analysis: Construct gene trees for TVP23 and compare with species trees to identify potential horizontal gene transfer or incomplete lineage sorting.

This approach would leverage the recent availability of high-quality genome assemblies for the Podospora species complex .

What strategies can be used to study TVP23 function in the context of Podospora anserina's long-term evolution?

The Podospora anserina long-term evolution experiment (PaLTEE) provides a valuable framework for studying protein evolution over time . To investigate TVP23 function in this context, researchers could:

  • Time-series sampling: Extract genomic DNA and RNA at regular intervals throughout the PaLTEE to track changes in TVP23 sequence and expression.

  • Mutation analysis: Monitor for SNPs or indels in the TVP23 gene and regulatory regions, which might indicate selection pressures during adaptation.

  • Parallel evolution assessment: Compare changes in TVP23 across independent lineages to identify convergent evolutionary patterns, as parallel evolution has been observed at the paralog level in P. anserina .

  • Experimental phenotyping: Characterize TVP23 function in evolved strains compared to ancestral strains using trafficking assays or subcellular localization studies.

This approach would build on the established framework of the PaLTEE, which has already demonstrated the linear accumulation of mutations over time and the occurrence of parallel evolution at the protein function level .

What techniques are most appropriate for investigating the role of TVP23 in vesicular trafficking within Podospora anserina?

To investigate TVP23's role in vesicular trafficking, researchers should consider these methodological approaches:

  • Live-cell imaging:

    • Use fluorescently-tagged cargo proteins to track vesicular movement

    • Implement pulse-chase experiments with photoactivatable fluorescent proteins

    • Apply super-resolution microscopy techniques like STED or PALM

  • Biochemical fractionation:

    • Develop differential centrifugation protocols specific for P. anserina organelles

    • Use density gradient separation to isolate Golgi-derived vesicles

    • Analyze TVP23 distribution across fractions by Western blotting

  • Trafficking assays:

    • Measure secretion rates of model cargo proteins in wild-type vs. TVP23 mutants

    • Implement temperature-sensitive trafficking blocks to identify specific steps requiring TVP23

  • Electron microscopy:

    • Apply immunogold labeling to localize TVP23 with nanometer precision

    • Use correlative light and electron microscopy (CLEM) for dynamic studies

The implementation of these techniques should account for the unique biology of filamentous fungi, which differs from the yeast models typically used for trafficking studies.

How can CRISPR-Cas9 technology be optimized for TVP23 gene editing in Podospora anserina?

While traditional transformation protocols exist for P. anserina , adapting CRISPR-Cas9 for TVP23 editing requires specific considerations:

  • Guide RNA design:

    • Target unique regions of TVP23 to avoid off-target effects

    • Consider GC content and secondary structure for optimal efficiency

    • Design multiple guide RNAs targeting different regions of the gene

  • Delivery methods:

    • Optimize protoplast preparation from P. anserina mycelia

    • Consider ribonucleoprotein (RNP) delivery to minimize off-target effects

    • Test different transformation methods (PEG-mediated, electroporation, Agrobacterium-mediated)

  • Repair template design:

    • Include at least 500 bp homology arms for efficient homology-directed repair

    • Consider incorporating silent mutations in the PAM site to prevent re-cutting

  • Screening strategies:

    • Develop PCR-based screening methods for identifying successful edits

    • Implement phenotypic screens if TVP23 modification results in visible changes

    • Sequence the entire target region to confirm the intended edit and check for unintended modifications

This methodological approach would build upon the established transformation protocols for P. anserina while introducing modern gene editing techniques for precise genetic manipulation.

How can TVP23 be used as a marker for Golgi dynamics during Podospora anserina's adaptation to different growth conditions?

TVP23's localization to the Golgi apparatus makes it an excellent candidate for studying organelle dynamics during adaptation processes. The following methodological framework is recommended:

  • Fluorescent protein tagging: Generate strains expressing TVP23-GFP or similar fluorescent fusions.

  • Experimental design:

    • Subject P. anserina to various growth conditions (solid vs. liquid media, different carbon sources, stress conditions)

    • Monitor Golgi morphology and distribution using live-cell imaging

    • Quantify parameters such as Golgi size, number, and motility

  • Comparative analysis:

    • Compare Golgi dynamics in wild-type vs. long-lived mutants like grisea

    • Analyze changes over time in long-term evolution experiments

This approach would provide insights into how secretory pathway reorganization contributes to adaptation, potentially contributing to the understanding of the pronounced phenotypic changes observed during adaptation to submerged cultivation .

What considerations should researchers keep in mind when designing functional assays for TVP23?

When designing functional assays for TVP23, researchers should implement the following methodological considerations:

  • Control for membrane protein-specific challenges:

    • Include appropriate detergents for in vitro assays

    • Consider lipid composition effects on protein activity

    • Verify proper folding and orientation in membrane systems

  • Select appropriate readouts:

    • Cargo trafficking rates for functional assessment

    • Protein-protein interaction strength for binding studies

    • Membrane association parameters for localization studies

  • Validation across multiple approaches:

    • Combine in vitro biochemical assays with in vivo functional studies

    • Use both gain-of-function and loss-of-function approaches

    • Implement rescue experiments with site-directed mutants to identify critical residues

  • Species-specific considerations:

    • Account for the unique biology of filamentous fungi compared to yeast models

    • Consider the potential impact of P. anserina's senescence mechanisms on assay interpretation

    • Adapt protocols to accommodate the mycelial growth pattern rather than unicellular systems

These methodological approaches ensure robust and reproducible functional characterization of TVP23 in the context of P. anserina biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.