Recombinant Podospora anserina Golgi apparatus membrane protein TVP38 (TVP38)

Shipped with Ice Packs
In Stock

Description

Functional Role and Biological Context

TVP38 is annotated as a Golgi apparatus membrane protein, though its specific molecular function in P. anserina remains underexplored. Homologs of TVP38 in other fungi, such as Kluyveromyces lactis, suggest potential roles in membrane organization or vesicle trafficking . In P. anserina, TVP38 is encoded by the gene TVP38 (UniProt ID: B2AMJ3), located on chromosome 5 (ORF: Pa_5_6980) .

Key Features of TVP38

PropertyDetails
SpeciesPodospora anserina (strain S/ATCC MYA-4624)
Gene NameTVP38 (Pa_5_6980)
Protein TypeRecombinant, full-length
TagDetermined during production (commonly His-tag in homologs)
Expression SystemEscherichia coli
Storage Conditions-20°C in Tris-based buffer with 50% glycerol; avoid freeze-thaw cycles

Research Applications

TVP38 is commercially available as an ELISA-ready recombinant protein, primarily utilized for:

  • Antibody production and validation .

  • Golgi membrane protein interaction studies.

  • Comparative analyses of fungal organelle dynamics .

Evolutionary and Genomic Insights

The TVP38 gene is part of the P. anserina genome (RefSeq Assembly: GCF_000226545.1), which encodes ~10,600 proteins . While TVP38 itself has not been directly linked to P. anserina’s well-characterized prion systems (e.g., het-s) or allorecognition pathways (e.g., het-B) , its conservation across fungi implies functional importance in cellular trafficking.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. Please specify your required tag type for preferential development.
Synonyms
TVP38; Pa_5_6980; PODANS_5_6980; Golgi apparatus membrane protein TVP38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
full length protein
Species
Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina)
Target Names
TVP38
Target Protein Sequence
MGPDEIEMVPPKTPRGLPPSETDYQPVNWKRLFLRPKYLAMWVVLVIIIILTAIITIYHD KVVEVGDIRHFDNVCGGKQEILTAHPLQHLRPFAEQVRHLPGGWLIPIVILIVISFPPLF GHEIIALLCGVVYGLWIGFGIVAAGTFLGEVGTWFAFKYLFRQKSEKLERTSLSYGALAR ITRDGGFWIVLIIRFSAIPTHFSTAVFSTCGVNFWIFAIATFLTLPKQIFLVYLGVLLLQ DKPDDAPKNIVFGIAFVLTIVMAGYIGFKMRFVKKILIEEQEERRKALAMPTMDDTVNTG DGVLDTERSEYEALSQNDFSIAMPGPAAGNHTPLGEPSKGPSTAPSGWTTEAVNTPDSPG TPPNEYFGQQPAKGFQWV
Uniprot No.

Target Background

Function
Recombinant *Podospora anserina* Golgi apparatus membrane protein TVP38 is a Golgi membrane protein involved in vesicular trafficking and spindle migration.
Database Links
Protein Families
TVP38/TMEM64 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Podospora anserina and why is it valued as a model organism in TVP38 research?

Podospora anserina is a coprophilous filamentous ascomycete that belongs to a large group of saprotrophic fungi primarily growing on herbivorous animal dung. It serves as an efficient laboratory model for studying various biological phenomena due to several advantageous characteristics. The organism grows rapidly at approximately 7 mm/day on standard medium and completes its life cycle in just one week, producing ascospores. Additionally, P. anserina is readily applicable in molecular genetics, cellular biology, and cytology research .

Its value specifically for TVP38 research stems from its well-characterized aging process and distinctive membrane protein organization. P. anserina plays an essential role in decomposing and recycling nutrients from animal feces in its natural biotope . The organism's controlled aging process makes it particularly suitable for studying membrane proteins like TVP38 and their potential roles in cellular aging and stress responses.

What experimental methods are recommended for purification of recombinant TVP38 protein?

Purification of recombinant Podospora anserina TVP38 protein typically follows a multi-step process optimized for membrane proteins:

  • Expression System Selection: The recombinant protein is commonly expressed in either bacterial (E. coli) or eukaryotic (yeast or insect cell) expression systems, with the latter often preferred for proper folding and post-translational modifications of membrane proteins.

  • Affinity Chromatography: The recombinant protein is typically expressed with affinity tags (determined during the production process) that facilitate purification using appropriate affinity resins .

  • Detergent Solubilization: Since TVP38 is a membrane protein, proper detergent selection is critical for maintaining protein stability and functionality during purification. Mild non-ionic detergents are typically employed.

  • Buffer Optimization: The storage buffer is typically Tris-based with 50% glycerol, specifically optimized for TVP38 stability .

  • Storage Considerations: For extended stability, the purified protein should be stored at -20°C or -80°C, with working aliquots maintained at 4°C for up to one week. Repeated freeze-thaw cycles should be avoided .

The quality of purified recombinant TVP38 should be assessed through techniques such as SDS-PAGE, Western blotting, and mass spectrometry to verify purity and integrity.

How might TVP38 interact with mitochondrial processes during aging in Podospora anserina?

Research on Podospora anserina aging has revealed significant alterations in mitochondrial dynamics during senescence, with potential implications for TVP38 function. While direct evidence of TVP38's role in mitochondrial processes is still emerging, several potential interaction pathways can be inferred:

  • Membrane Contact Sites: TVP38, as a Golgi membrane protein, may participate in the formation of membrane contact sites between the Golgi apparatus and mitochondria. During aging in P. anserina, the accumulation of functionally impaired mitochondria coincides with pronounced changes in mitochondrial morphology and ultrastructure .

  • Protein Complex Interactions: Complexome profiling studies in aged P. anserina have identified age-dependent alterations in mitochondrial protein complexes, particularly those involved in oxidative phosphorylation (OXPHOS). These changes include the loss of mitochondrial respiratory supercomplexes (mtRSCs) and reduced abundance of complex I and complex IV . TVP38 could potentially influence these processes through direct or indirect interactions with components of these complexes.

  • Response to Respiratory Switching: P. anserina exhibits an age-associated switch from standard complex IV-dependent respiration to alternative oxidase (AOX)-dependent respiration . This metabolic adaptation may involve signaling pathways that include membrane proteins like TVP38.

  • Salvage Pathway Involvement: During aging, non-mitochondrial salvage pathways are induced to counteract mitochondrial impairments. Components of the proteasome and endoplasmic reticulum proteins show increased recruitment to mitochondria in older cultures . As a Golgi membrane protein, TVP38 could participate in these compensatory mechanisms, potentially through vesicle trafficking or direct membrane interactions.

Experimental approaches to further elucidate these relationships could include co-immunoprecipitation studies, fluorescence microscopy to track TVP38 localization during aging, and genetic manipulation of TVP38 expression to observe effects on mitochondrial function and aging rate.

What methodological approaches can reveal TVP38's role in fungal growth and hyphal network formation?

Investigating TVP38's potential role in hyphal network formation requires sophisticated methodological approaches that combine molecular techniques with advanced imaging:

  • Automated Growth Tracking Systems: Utilizing automated experimental devices similar to those developed for tracking P. anserina hyphal network construction on planar surfaces . Such systems allow for monitoring time series of fungal thallus development under standardized conditions.

  • Quantitative Network Analysis: Employing robust image analysis to extract reproducible quantitative parameters such as:

    • Total length of mycelium

    • Number of nodes or vertices (hyphal fusion and branching points)

    • Number of apexes

    • Branching dynamics and spatio-temporal patterns

  • Gene Deletion and Complementation Studies: Creating ΔTvp38 knockout strains and complemented strains to compare:

    • Growth rate and morphology

    • Hyphal network architecture

    • Aging processes

    • Stress tolerance

    • Interspecific confrontation capacity

  • Mathematical Modeling: Applying two-dimensional simulation models based on binary-tree modeling to extract the main characteristics of thallus growth . Parameters to measure include:

    • Apical growth patterns

    • Branching angles and frequency

    • Hyphal fusion events

    • Network resilience under environmental stress

ParameterWild-Type P. anserinaHypothetical ΔTvp38 Mutant
Growth Rate7 mm/day (standard)To be determined experimentally
Colony MorphologyFluffy with extensive aerial hyphaeMay show altered morphology similar to other membrane protein mutants
Network ComplexityComplex with regular branchingPotentially reduced complexity
Aging CharacteristicsNormal progressionMay show accelerated or delayed aging
Branching AngleOptimized for environmental explorationMay show suboptimal patterns

Research approaches should account for both generation (theoretical growth based on probability laws) and detection (observation process) to accurately characterize network development .

How does TVP38 potentially interact with stress response pathways in Podospora anserina?

The potential role of TVP38 in stress response pathways can be investigated through multiple experimental approaches, drawing parallels from studies of other regulatory factors in P. anserina:

  • Oxidative Stress Response: Studies of transcription factors like PaNsdD have shown their importance in stress tolerance in P. anserina . Similarly, TVP38 could be evaluated for its potential role in oxidative stress response through:

    • Measuring reactive oxygen species (ROS) accumulation using nitroblue tetrazolium (NBT) detection assays in wild-type versus TVP38-mutant strains

    • Assessing peroxide accumulation patterns during normal growth and under stress conditions

    • Evaluating superoxide production across the fungal thallus

  • Interspecific Confrontation Assays: Challenging wild-type and TVP38-mutant P. anserina strains with fungal competitors (such as Penicillium chrysogenum, Botrytis cinerea, and Trametes versicolor) to assess:

    • Cell death patterns in the contact zone

    • Competitive advantage or disadvantage

    • Molecular signals triggered during the confrontation

  • Membrane Stress Analysis: As a membrane protein, TVP38 may play specific roles in membrane integrity and adaptation to membrane stress. Research approaches could include:

    • Lipidomic analysis to detect membrane composition changes in response to stress

    • Fluidity assessments using fluorescent membrane probes

    • Membrane integrity assays under various stress conditions

  • Secondary Metabolite Production: Stress responses in P. anserina often involve altered secondary metabolite production. TVP38's potential role could be investigated by:

    • Metabolomic profiling of wild-type versus TVP38-mutant strains

    • Quantification of specific metabolites like 3-acetyl-4-methylpyrrole under different stress conditions

    • Analysis of pigment production, which may serve as visual indicators of stress response

These methodological approaches would provide comprehensive insights into TVP38's potential roles in coordinating membrane-dependent stress responses in P. anserina.

What techniques are most effective for studying TVP38's involvement in Golgi-to-mitochondria communication?

Investigating the potential role of TVP38 in Golgi-to-mitochondria communication requires specialized techniques that can detect subtle protein-protein interactions and organelle proximity:

  • Proximity Labeling Techniques:

    • BioID or TurboID fusion proteins can identify proteins in close proximity to TVP38

    • APEX2-based proximity labeling to map the TVP38 interactome in living cells

    • These approaches can reveal transient interactions that traditional co-immunoprecipitation might miss

  • Advanced Microscopy Methods:

    • Super-resolution microscopy (STED, PALM, or STORM) to visualize potential contact sites

    • Live-cell imaging with dual fluorescent protein tagging to track dynamic interactions

    • Correlative light and electron microscopy (CLEM) to combine functional information with ultrastructural detail

    • Fluorescence resonance energy transfer (FRET) to detect protein-protein interactions

  • Organelle Proximity Assessment:

    • Split fluorescent protein systems positioned at Golgi and mitochondrial interfaces

    • Quantitative assessment of organelle proximity using automated image analysis

    • Optogenetic tools to artificially induce or disrupt organelle contacts

  • Complexome Profiling:

    • Blue native polyacrylamide gel electrophoresis (BN-PAGE) combined with quantitative mass spectrometry to separate high molecular weight protein complexes

    • Analysis of protein migration patterns in different molecular weight regions using heatmaps

    • Comparison of profiles between different age stages or genetic backgrounds

  • Mitochondrial Function Assessment:

    • Oxygen consumption measurements to detect respiratory changes

    • Analysis of alternative oxidase (AOX) activation

    • Assessment of mitochondrial membrane potential using fluorescent probes

TechniqueApplicationAdvantagesLimitations
Complexome ProfilingIdentification of protein complexesDetects native protein assembliesLabor-intensive, requires specialized equipment
Proximity LabelingMapping protein neighborhoodsCaptures transient and weak interactionsPotential false positives, requires genetic modification
Super-resolution MicroscopyVisualizing organelle contactsHigh spatial resolutionTechnically challenging, potential artifacts
Split Fluorescent ProteinsDetecting organelle proximityDirect visualization of contactsMay alter native protein function
RespirometryAssessing mitochondrial functionFunctional readoutIndirect measure of protein interaction

These techniques, especially when used in combination, can provide comprehensive insights into the potential role of TVP38 in facilitating communication between the Golgi apparatus and mitochondria during normal growth and aging processes.

How might TVP38 contribute to the proteostasis network during aging in Podospora anserina?

Research on P. anserina aging has revealed that components of the proteasome show increased recruitment to mitochondria in older cultures, suggesting induction of compensatory salvage pathways during aging . TVP38, as a membrane protein, may participate in this adaptive response through several potential mechanisms:

  • Membrane-Associated Degradation: TVP38 could facilitate the recognition or recruitment of misfolded or damaged proteins to degradation machinery. This function would be particularly relevant during aging when protein damage accumulates.

  • Vesicular Transport of Degradation Components: As a Golgi membrane protein, TVP38 might participate in the trafficking of vesicles containing proteasomal components or other proteolytic enzymes to mitochondria or other cellular compartments experiencing proteotoxic stress during aging.

  • Stress Sensing and Signaling: TVP38 could function as a sensor of membrane or organelle stress, initiating signaling cascades that upregulate proteostasis mechanisms.

Experimental approaches to investigate these possibilities include:

  • Quantitative proteomics comparing wild-type and TVP38-deficient strains at different age stages

  • Tracking proteasome component localization in relation to TVP38 using fluorescent tags

  • Measuring proteolytic activity and protein aggregation in TVP38 mutants versus wild-type strains

These investigations would provide valuable insights into the potential role of TVP38 in maintaining proteostasis during the aging process of P. anserina.

What is the relationship between TVP38 and secondary metabolite production in Podospora anserina?

Podospora anserina has been identified as a prolific but largely unexplored reservoir of natural products . The potential relationship between TVP38 and secondary metabolite production represents an intriguing research direction:

  • Metabolomic Profiling: Comparative metabolomic analysis between wild-type and TVP38-mutant strains could reveal:

    • Alterations in specific metabolite profiles

    • Changes in recently identified compounds such as 3-acetyl-4-methylpyrrole

    • Novel metabolites whose production depends on proper Golgi function

  • Vesicular Trafficking of Biosynthetic Enzymes: As a Golgi membrane protein, TVP38 might participate in:

    • Proper localization of enzymes involved in secondary metabolite biosynthesis

    • Formation of specialized vesicles for compartmentalized biosynthesis

    • Transport of secondary metabolites to their final cellular destinations

  • Regulatory Network Integration: TVP38 could potentially interact with regulatory pathways that control secondary metabolism:

    • Possible connections to transcription factors like PaNsdD that govern secondary metabolism

    • Potential coordination with the sterigmatocystin biosynthetic pathway

    • Response to environmental signals that trigger metabolite production

This research direction would not only illuminate TVP38's functional roles but could also potentially identify novel bioactive compounds with scientific and therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.