Recombinant Podospora anserina High osmolarity signaling protein SHO1 (SHO1)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Podospora anserina SHO1 Protein

The High osmolarity signaling protein SHO1 from Podospora anserina functions as an osmosensor, playing a critical role in the organism's ability to detect and respond to changes in environmental osmolarity. The protein is officially designated with the UniProt accession number B2ANF9 and is coded by the SHO1 gene (ORF designation: CDS Pa_6_10750). The full-length protein spans 317 amino acids and is expressed as a recombinant product for research applications .

Podospora anserina has gained significant attention as a model organism for studying various biological processes, particularly in research related to aging and mitochondrial function. This filamentous fungus demonstrates pronounced age-dependent changes in mitochondrial morphology, ultrastructure, and protein expression, including alterations in oxidative phosphorylation (OXPHOS) complexes . Within this context, signaling proteins like SHO1 may contribute to adaptive responses that help the organism respond to environmental stressors during various life stages.

The recombinant version of Podospora anserina SHO1 protein is produced through molecular biology techniques to generate purified protein for research applications. This enables scientists to study its structure, function, and potential applications without the complexities associated with extracting native protein directly from fungal cultures.

Functional Role in Osmotic Stress Response

The High osmolarity signaling protein SHO1 functions as a critical osmosensor in Podospora anserina, allowing the organism to detect and respond to changes in environmental osmolarity. This function is particularly important for filamentous fungi that must adapt to varying environmental conditions.

In fungi, osmotic stress triggers specific signaling cascades that lead to adaptive responses. SHO1 proteins typically function at the cell membrane, where they detect changes in membrane tension or conformation resulting from osmotic shifts. Upon sensing these changes, they initiate signaling pathways that ultimately lead to transcriptional and metabolic adaptations.

The function of SHO1 in Podospora anserina likely parallels its role in other fungal species, where it integrates into mitogen-activated protein kinase (MAPK) cascades that respond to various environmental stressors. Given Podospora anserina's role as a model organism for aging studies, the functioning of stress response proteins like SHO1 may provide insights into how cellular adaptation mechanisms change throughout the organism's lifespan.

As Podospora anserina ages, it experiences significant alterations in mitochondrial dynamics and protein expression patterns . The potential relationship between osmotic stress signaling pathways (involving SHO1) and these age-related changes represents an interesting avenue for future research.

Production Methodology

The recombinant Podospora anserina SHO1 protein is produced using standard molecular biology techniques. While specific production methods are not detailed in the available data, typical approaches involve:

  1. Cloning the SHO1 gene from Podospora anserina genomic DNA

  2. Inserting the gene into an expression vector

  3. Transforming the construct into a suitable host organism (commonly E. coli)

  4. Inducing protein expression

  5. Purifying the recombinant protein using affinity chromatography

The production process may incorporate tags to facilitate purification and detection, although the specific tag information for the commercially available Podospora anserina SHO1 is noted to be determined during the production process .

Enzyme-Linked Immunosorbent Assay (ELISA)

One primary application of the recombinant Podospora anserina SHO1 protein is in Enzyme-Linked Immunosorbent Assay (ELISA) methodologies. The commercially available product is specifically marketed as "ELISA Recombinant Podospora anserina High osmolarity signaling protein SHO1," indicating its optimization for this application . ELISA techniques can be utilized to:

  1. Detect antibodies against SHO1 in research samples

  2. Investigate protein-protein interactions involving SHO1

  3. Study the binding affinities of potential inhibitors or activators

  4. Quantify SHO1 expression levels in various experimental conditions

Aging and Mitochondrial Research

Given Podospora anserina's established role as a model organism for aging studies, the SHO1 protein presents opportunities for investigating the relationship between osmotic stress response and age-related cellular changes. Research has documented pronounced age-dependent alterations in mitochondrial morphology, ultrastructure, and function in Podospora anserina .

The interconnection between stress response pathways (including those involving SHO1) and these mitochondrial changes remains an area ripe for exploration. The recombinant protein enables targeted studies to elucidate these relationships through:

  1. Protein interaction studies to identify binding partners

  2. Functional assays to assess signaling capacity at different life stages

  3. Comparative analyses between young and aged Podospora anserina samples

Comparative Studies with Other Fungal Species

The availability of recombinant SHO1 proteins from different fungal species, including both Podospora anserina and Pichia angusta , facilitates comparative studies of osmosensing mechanisms across fungal taxa. Such studies can reveal evolutionary conservation and divergence in stress response pathways, potentially informing broader understanding of adaptation mechanisms in fungi.

Future Research Directions

The study of Recombinant Podospora anserina SHO1 protein opens several promising avenues for future research:

Structure-Function Relationships

Detailed structural characterization through techniques such as X-ray crystallography or cryo-electron microscopy could elucidate the precise three-dimensional configuration of the protein. This structural information would enhance understanding of its sensing mechanism and interaction with other cellular components.

Integration with Aging Research

Further investigation into how the SHO1-mediated osmotic stress response changes throughout the Podospora anserina lifespan could provide insights into the relationship between stress adaptation and aging. Recent research has already established that aging in Podospora anserina leads to alterations in oxidative phosphorylation and mitochondrial function . Exploring whether osmotic stress response pathways similarly change with age represents a logical extension of this work.

Genetic Studies

Genetic manipulation studies, such as those conducted on the MAT-proximal region of Podospora anserina , could be applied to the SHO1 gene to investigate its regulation and function in vivo. Such approaches might reveal how SHO1 gene expression is controlled under various stress conditions and throughout different developmental stages.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on your location and purchasing method. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please let us know and we will prioritize developing it accordingly.
Synonyms
SHO1; Pa_6_10750; PODANS_6_10750; High osmolarity signaling protein SHO1; Osmosensor SHO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina)
Target Names
SHO1
Target Protein Sequence
MPNYGSLHSPSLRKMEQSRIQYGRKRLSLGNIIGDPFALATISIAFLAWIISFFGSLFAH INQPPNTPGVNNSFPLYTWWAVVFYFFLVVGVFIVVASDSVQTYHVAIVGYLGCGLVLST SAVHGLIYSNIGSREAAAAGMILLAMVTIVWIFYFGSAPSAVPRAYIDSFALAKESSTNR QTMNTGYGIGRPETSTSVQPPQMYTAQLNGLENPSPVGGMQSSGMRNSAVPPPFQSTLGQ KSNGLPGSSDGDIAPPTEYPYRAKAIYSYEANPEDANEISFQKHEILEVSDVSGRWWQAR KENGDTGIAPSNYLILL
Uniprot No.

Target Background

Function
This protein serves as a plasma membrane osmosensor, activating the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity.
Database Links
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the SHO1 protein in Podospora anserina and what is its primary function?

SHO1 (High osmolarity signaling protein) in Podospora anserina is a four-transmembrane domain protein that functions as an osmosensor and scaffolding protein. Based on research in related organisms, SHO1 likely plays a crucial role in the fungal high osmolarity response pathway, similar to its homolog in yeast . The protein contains four transmembrane domains and is involved in sensing changes in external osmolarity, triggering appropriate cellular responses to maintain osmotic homeostasis. The full-length protein consists of 317 amino acids and contains distinct domains that contribute to its sensing and signaling functions .

How is the structure of P. anserina SHO1 characterized?

The P. anserina SHO1 protein (UniProt: B2ANF9) contains four transmembrane domains with a specific architectural arrangement. The protein features a cytoplasmic region with binding sites for interacting proteins involved in signaling cascades. The amino acid sequence indicates that SHO1 likely forms oligomeric structures through specific interfaces between its transmembrane domains .

Similar to yeast SHO1, the P. anserina protein likely forms planar oligomers with a dimers-of-trimers architecture, dimerizing at the TM1/TM4 interface and trimerizing at the TM2/TM3 interface. This structural arrangement is critical for its function as both an osmosensor and a scaffold that brings together various components of the osmotic stress response pathway .

What are the optimal expression systems for producing recombinant P. anserina SHO1?

For recombinant expression of P. anserina SHO1, researchers should consider several expression systems based on the intended application:

  • E. coli expression systems: Suitable for producing large quantities of recombinant protein for structural studies, though membrane proteins like SHO1 may require specialized strains (such as C41/C43) and detergent optimization for proper folding and solubilization.

  • Yeast expression systems: S. cerevisiae or P. pastoris can provide a eukaryotic environment with proper post-translational modifications and membrane insertion machinery that may be advantageous for functional studies of SHO1.

  • Baculovirus-insect cell systems: For higher eukaryotic expression when protein yield and proper folding are priorities.

The choice of expression tag (His, GST, MBP) should be determined during the production process to optimize for protein stability and functionality . When expressing membrane proteins like SHO1, it's critical to maintain the integrity of transmembrane domains and ensure proper insertion into membranes. Expression conditions including temperature, induction time, and media composition should be optimized for each specific system.

What purification strategies are most effective for obtaining functional SHO1 protein?

Purification of membrane proteins like SHO1 requires specific strategies:

  • Detergent screening: Test multiple detergents (e.g., DDM, LMNG, CHAPS) to identify optimal conditions for extraction while maintaining protein structure and function.

  • Two-phase purification approach:

    • Initial capture using affinity chromatography (based on the expression tag)

    • Secondary purification using size exclusion chromatography to isolate properly folded oligomeric states

  • Stability optimization: Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage to prevent repeated freeze-thaw cycles .

For functional studies, it's crucial to verify that the purified protein maintains its native oligomeric state (dimers-of-trimers architecture) and osmosensing capabilities. This can be assessed through biophysical techniques such as analytical ultracentrifugation, multi-angle light scattering, or native PAGE.

How can researchers validate the functional activity of recombinant SHO1 protein?

To validate that recombinant SHO1 maintains its functional activity:

  • Oligomerization assays: Crosslinking studies to confirm the formation of the characteristic dimers-of-trimers architecture observed in yeast SHO1 .

  • Binding partner interactions: In vitro binding assays to verify interaction with known SHO1 binding partners such as adaptor proteins (similar to Ste50 in yeast) .

  • Membrane insertion verification: Liposome reconstitution assays to confirm proper membrane insertion and topology.

  • Osmosensing functionality: Assays to detect structural changes in response to osmotic stress conditions, which could include:

    • FRET-based conformational change assays

    • Limited proteolysis patterns under different osmotic conditions

    • Hydrogen-deuterium exchange mass spectrometry to identify regions that undergo conformational changes

  • Functional complementation: Transformation of SHO1-deficient fungal strains with the recombinant protein to assess rescue of osmosensitivity phenotypes.

How does SHO1 integrate into the HOG signaling pathway in Podospora anserina?

Based on yeast studies, SHO1 likely plays a dual role in P. anserina's HOG pathway:

  • Osmosensing function: SHO1's transmembrane domains detect changes in external osmolarity, triggering conformational changes in the protein structure .

  • Scaffolding function: The oligomeric SHO1 complex serves as a platform that brings together multiple signaling components .

To investigate this integration, researchers should consider:

  • Protein interaction studies: Identify P. anserina-specific binding partners through techniques such as co-immunoprecipitation coupled with mass spectrometry, yeast two-hybrid screening, or proximity labeling approaches.

  • Phosphorylation cascade analysis: Map the signaling events downstream of SHO1 activation using phosphoproteomic approaches to identify the kinase cascade (likely analogous to the Ste20-Ste11-Pbs2-Hog1 cascade in yeast) .

  • Domain-specific functional analysis: Generate mutants with alterations in specific interfaces (TM1/TM4 and TM2/TM3) to dissect the contribution of dimerization and trimerization to signaling functions .

What methodologies can be used to study SHO1's role in osmotic stress adaptation in P. anserina?

To investigate SHO1's role in osmotic stress adaptation:

  • Genetic approaches:

    • CRISPR-Cas9 gene editing to create SHO1 knockout or domain-specific mutants

    • Complementation studies with wild-type or modified SHO1 variants

    • Epistasis analysis with other components of the osmotic stress response pathway

  • Cellular localization studies:

    • Fluorescent protein tagging to track SHO1 localization under different osmotic conditions

    • Super-resolution microscopy to visualize oligomer formation and distribution

  • Physiological assessment:

    • Growth assays under various osmotic stress conditions

    • Glycerol production measurement as an indicator of HOG pathway activation

    • Time-course analysis of cellular responses to osmotic shock

  • Transcriptional profiling:

    • RNA-seq analysis comparing wild-type and SHO1-deficient strains under osmotic stress

    • ChIP-seq to identify downstream transcription factors regulated by the SHO1-initiated signaling cascade

How can structural studies of SHO1 inform its function in osmosensing?

Advanced structural studies can provide crucial insights into SHO1's osmosensing mechanism:

  • Cryo-electron microscopy approaches:

    • Single-particle analysis of the purified SHO1 complex to resolve the dimers-of-trimers architecture

    • Visualization of conformational changes under different osmotic conditions

  • Crosslinking mass spectrometry (XL-MS):

    • Identification of specific residues involved in protein-protein interactions within the oligomer

    • Mapping interfaces between SHO1 and its binding partners

  • Molecular dynamics simulations:

    • In silico modeling of how osmotic changes affect membrane properties and SHO1 transmembrane domains

    • Prediction of conformational changes that trigger downstream signaling

  • Site-directed spin labeling combined with EPR spectroscopy:

    • Measurement of distances between specific residues to track conformational changes in response to osmotic stress

    • Determination of the dynamics of the transmembrane domains during signaling

How does P. anserina SHO1 compare functionally with related proteins in the fungal kingdom?

The SHO1 protein represents a conserved osmosensing mechanism across fungi, with some notable variations:

SpeciesSHO1 FunctionPathway IntegrationUnique Features
P. anserinaOsmosensing and likely scaffoldingPresumed HOG pathway componentFull sequence characterized, 317 amino acids
S. cerevisiaeOsmosensor in HKR1 sub-branch of HOG pathwayForms complex with Opy2 and Hkr1Well-characterized dimers-of-trimers architecture
Other filamentous fungiVaried osmosensing rolesDiverse stress response pathway integrationSpecies-specific adaptations

To investigate evolutionary relationships:

  • Phylogenetic analysis: Compare SHO1 sequences across fungal species to trace evolutionary history and identify conserved functional domains.

  • Functional complementation: Express SHO1 from different species in P. anserina SHO1-knockout strains to assess functional conservation.

  • Comparative interactome studies: Identify species-specific differences in binding partners that might reflect adaptation to different ecological niches.

What is known about the relationship between SHO1 and other signaling systems in P. anserina?

While specific data on P. anserina is limited in the provided search results, research can focus on potential crosstalk between osmotic signaling and other pathways:

  • Sexual development pathway interactions: Investigate potential connections between osmotic signaling and the meiotic development processes studied in P. anserina .

  • Cell wall integrity pathway: Examine whether SHO1-mediated signaling interacts with cell wall remodeling mechanisms, particularly under stress conditions.

  • Nutrient sensing pathways: Explore connections between osmotic stress responses and nutrient availability sensing.

To investigate these relationships, researchers should consider:

  • Genetic interaction screens: Systematic analysis of genetic interactions between SHO1 and components of other signaling pathways.

  • Phosphoproteomic analysis: Identification of shared phosphorylation targets between multiple stress response pathways.

  • Transcriptional profiling: Analysis of gene expression patterns under various stress conditions to identify common regulatory elements.

How can CRISPR-Cas9 be optimized for SHO1 gene editing in P. anserina?

For effective CRISPR-Cas9 editing of the SHO1 gene in P. anserina:

  • sgRNA design considerations:

    • Target unique regions with minimal off-target potential

    • Consider the GC-rich nature of fungal genomes when designing guides

    • Validate guide RNA efficiency in silico before experimental implementation

  • Delivery methods:

    • Optimize protoplast transformation protocols specifically for P. anserina

    • Consider transient expression systems for Cas9 to minimize potential toxicity

    • Implement ribonucleoprotein (RNP) delivery to improve editing efficiency

  • Homology-directed repair templates:

    • Design with ~1kb homology arms for efficient integration

    • Include selectable markers appropriate for P. anserina

    • Consider silent mutations in the PAM site to prevent re-cutting

  • Validation strategies:

    • Implement both PCR-based screening and sequencing validation

    • Verify protein expression changes through western blotting

    • Confirm functional consequences through osmotic stress response assays

What phenotypic assays are most informative for studying SHO1 function in P. anserina?

To comprehensively assess SHO1 function in P. anserina, researchers should implement multiple phenotypic assays:

  • Growth assays under osmotic stress:

    • Compare growth rates on media containing various osmolytes (NaCl, sorbitol, KCl)

    • Assess recovery after acute osmotic shock

    • Measure hyphal extension rates under gradient osmotic conditions

  • Subcellular localization:

    • Track SHO1-fluorescent protein fusions during osmotic stress exposure

    • Monitor co-localization with other HOG pathway components

    • Observe redistribution patterns in response to stress induction

  • Sexual development assessment:

    • Evaluate the impact of SHO1 deletion on perithecium formation

    • Assess ascospore development and viability

    • Measure meiotic progression under varying osmotic conditions

  • Molecular response indicators:

    • Measure glycerol accumulation rates in response to osmotic stress

    • Monitor Hog1-homolog phosphorylation kinetics

    • Assess transcriptional changes of known osmotic stress response genes

How can researchers develop an in vitro system to study SHO1 conformational changes in response to osmotic stress?

An in vitro system to study SHO1 conformational changes would be valuable for mechanistic understanding:

  • Liposome reconstitution approach:

    • Incorporate purified recombinant SHO1 into liposomes of defined lipid composition

    • Create osmotic gradients across the liposome membrane

    • Monitor conformational changes through spectroscopic methods

  • FRET-based conformational sensors:

    • Engineer SHO1 variants with fluorescent protein pairs at strategic positions

    • Measure FRET efficiency changes under varying osmotic conditions

    • Correlate FRET changes with functional outcomes

  • Surface plasmon resonance (SPR) binding studies:

    • Immobilize SHO1 on sensor chips in native-like membrane environments

    • Measure binding kinetics of downstream effectors under various osmotic conditions

    • Determine how osmotic stress modulates protein-protein interactions

  • Hydrogen-deuterium exchange mass spectrometry:

    • Identify regions of SHO1 that undergo structural rearrangements during osmotic stress

    • Map conformational changes to specific functional domains

    • Develop a dynamic model of the osmosensing mechanism

What are the major challenges in expressing and purifying functional SHO1 protein?

Researchers face several challenges when working with membrane proteins like SHO1:

  • Membrane protein solubility issues:

    • Solution: Screen multiple detergents systematically; consider amphipols or nanodiscs for maintaining native-like membrane environments

    • Alternative approach: Focus on expressing soluble domains separately when full-length protein proves challenging

  • Maintaining oligomeric structure:

    • Solution: Use mild solubilization conditions and crosslinking approaches to preserve native oligomeric states

    • Validation: Employ analytical ultracentrifugation to confirm proper assembly

  • Functional verification:

    • Solution: Develop activity assays that can be performed in detergent-solubilized or reconstituted systems

    • Alternative: Use binding to known partners as a proxy for functional integrity

  • Storage stability:

    • Solution: Maintain in appropriate buffer conditions with 50% glycerol at -20°C or -80°C

    • Recommendation: Prepare small aliquots to avoid repeated freeze-thaw cycles

How can researchers address contradictory results when studying SHO1 function across different experimental systems?

When confronting contradictory results:

  • Standardize experimental conditions:

    • Develop consistent protocols for osmotic stress application

    • Establish clear timepoints for measurements to account for temporal differences in responses

    • Use identical growth media compositions across experiments

  • Consider genetic background effects:

    • Perform complementation studies in identical genetic backgrounds

    • Account for potential strain-specific adaptations (as seen in P. anserina strain variations)

    • Document the complete genotype of all strains used

  • Validate across multiple methodologies:

    • Confirm key findings using orthogonal techniques

    • Combine genetic, biochemical, and cell biological approaches

    • Implement both in vivo and in vitro systems when possible

  • Address system-specific limitations:

    • Acknowledge differences between heterologous expression systems

    • Consider species-specific interaction partners that may be absent in certain systems

    • Document all experimental variables that could influence outcomes

What controls are essential when studying the specificity of SHO1 responses to osmotic stress versus other cellular stresses?

To establish specificity of SHO1 responses:

  • Essential negative controls:

    • Non-osmotic stress inducers (heat shock, oxidative stress, nutrient limitation)

    • Structurally related but functionally distinct membrane proteins

    • SHO1 mutants with disrupted sensing domains but intact scaffolding functions

  • Positive control considerations:

    • Include known osmotic stress response inducers at standardized concentrations

    • Use established osmotic stress response markers (e.g., Hog1 phosphorylation)

    • Implement time-course analyses to distinguish immediate versus adaptive responses

  • Specificity validation approaches:

    • Conduct detailed dose-response studies across multiple stress types

    • Perform genetic epistasis analysis with components specific to different stress pathways

    • Use pharmacological inhibitors to dissect pathway contributions

  • System-wide control measurements:

    • Monitor global cellular responses (transcriptome, proteome) to identify specific versus general stress responses

    • Track multiple cellular parameters simultaneously (e.g., cell volume, membrane integrity, metabolic activity)

What are promising approaches for studying the interaction between SHO1 and the cytoskeleton during osmotic adaptation?

The relationship between osmosensing and cytoskeletal rearrangements represents an important research frontier:

  • Live-cell imaging approaches:

    • Implement dual-color imaging of SHO1 and cytoskeletal elements during osmotic stress

    • Use lattice light-sheet microscopy for high-resolution 3D dynamics

    • Apply FRAP (Fluorescence Recovery After Photobleaching) to measure mobility changes

  • Proximity labeling methods:

    • Employ BioID or APEX2 fusions with SHO1 to identify cytoskeletal proteins that interact during stress

    • Conduct temporal analysis of the proximal proteome during osmotic stress response

  • Mechanical force measurement:

    • Apply microfluidic devices to apply controlled osmotic gradients while measuring cellular forces

    • Use traction force microscopy to assess how SHO1-dependent signaling affects cell-substrate interactions

  • Genetic interaction studies:

    • Create double mutants of SHO1 and cytoskeletal regulators

    • Assess synthetic phenotypes that reveal functional connections

What potential biotechnological applications might emerge from deeper understanding of fungal osmosensing mechanisms?

Advanced knowledge of SHO1 and fungal osmosensing could enable various applications:

  • Engineered stress tolerance:

    • Develop fungal strains with enhanced osmotolerance for industrial fermentation

    • Create agricultural biotechnology solutions for drought resistance

    • Engineer synthetic osmosensing circuits with tunable response characteristics

  • Antifungal drug development:

    • Target SHO1-dependent pathways in pathogenic fungi

    • Develop screens for compounds that disrupt osmotic adaptation

    • Create combination therapies that simultaneously target multiple stress response mechanisms

  • Biosensor development:

    • Engineer SHO1-based biosensors for environmental osmolarity monitoring

    • Develop reporter systems for real-time visualization of osmotic stress in research applications

    • Create cell-based biosensors for industrial process monitoring

  • Synthetic biology platforms:

    • Repurpose SHO1 signaling components as modular parts for synthetic signal transduction systems

    • Develop orthogonal osmosensing systems for programmed cellular behaviors

    • Create synthetic cell-cell communication systems based on osmotic signal transduction principles

What are the most significant unanswered questions about P. anserina SHO1?

Despite advances in understanding fungal osmosensing, several critical questions remain:

  • Structural dynamics: How do the transmembrane domains of SHO1 detect osmotic changes at the molecular level? What conformational changes propagate the signal?

  • Species-specific adaptations: How has the SHO1 signaling system evolved in P. anserina compared to other fungi, and how do these differences reflect ecological adaptations?

  • Integration with development: What is the relationship between osmotic stress sensing and key developmental processes in P. anserina, particularly during sexual reproduction?

  • Signaling specificity: How does SHO1 distinguish between osmotic stress and other membrane perturbations, and how is this specificity encoded in the signaling network?

  • Temporal dynamics: What are the timescales of SHO1 activation, adaptation, and reset, and how do these dynamics contribute to osmotic homeostasis?

How can interdisciplinary approaches advance SHO1 research?

Progress in understanding SHO1 will benefit from integrating multiple disciplines:

  • Structural biology + computational modeling: Combine experimental structural data with molecular dynamics simulations to understand the mechanics of osmosensing.

  • Systems biology + evolutionary biology: Integrate network analyses with comparative genomics to understand how osmosensing systems have evolved across fungal lineages.

  • Synthetic biology + biophysics: Develop minimal reconstituted systems to test mechanistic hypotheses about membrane protein function in controlled environments.

  • Cell biology + physics: Apply concepts from soft matter physics to understand how membrane properties influence SHO1 function during osmotic challenges.

  • Genetics + ecology: Connect laboratory phenotypes with ecological fitness under naturally fluctuating environments to understand the adaptive significance of osmosensing variations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.