Recombinant Podospora anserina Peroxisomal biogenesis factor 2 (PEX2)

Shipped with Ice Packs
In Stock

Description

Introduction to PEX2 in Podospora anserina

PEX2 is a peroxisomal membrane protein belonging to the RING-finger complex (PEX2-PEX10-PEX12), which is essential for peroxisome biogenesis and matrix protein import . In P. anserina, PEX2 is indispensable for sexual reproduction, particularly during meiocyte formation and meiotic commitment . Recombinant PEX2 allows functional studies of these processes by enabling genetic complementation, protein interaction assays, and structural analyses.

Protein Characteristics

  • Molecular Weight: ~35 kDa (predicted for the native protein) .

  • Domains: Contains a RING-finger domain critical for ubiquitination-mediated protein import .

  • Localization: Integral peroxisomal membrane protein .

Biological Roles

  • Matrix Protein Import: Facilitates the import of peroxisomal matrix proteins with PTS1/PTS2 targeting signals via collaboration with receptors PEX5 and PEX7 .

  • Developmental Regulation: Required for dikaryotic cell differentiation and meiocyte formation during sexual reproduction .

  • Mitochondrial Crosstalk: Modulates mitochondrial morphology and fission through peroxisome-mitochondria interactions .

Production and Purification

Recombinant PEX2 is produced in heterologous systems such as E. coli, yeast (Komagataella pastoris), and mammalian cells . Key specifications include:

Host SystemPurityApplicationsSource
E. coli≥85%Structural studies, antibody production
Yeast≥85%Functional complementation assays
Mammalian Cells (HEK293)≥85%Ubiquitination studies, protein interaction

Key Findings from Studies

Study FocusKey ResultImplicationSource
PEX2 DeficiencyBlocks sexual development at dikaryotic stage; disrupts mitochondrial fissionLinks peroxisomes to developmental signaling
Overexpression EffectsSuppresses peroxisome biogenesis defects but causes new developmental issuesHighlights dosage sensitivity of ABC transporters
RING-Finger ComplexPEX2-PEX10-PEX12 complex required for meiocyte formation, independent of importReveals dual roles in biogenesis and development
PEX2-PEX5 InteractionPEX5 deletion increases PEX13-GFP levels, altering peroxisome dynamicsSuggests feedback regulation in import machinery

Role in Sexual Development

  • PEX2-deficient strains fail to form meiocytes, arresting at the dikaryotic stage .

  • The RING-finger complex (PEX2-PEX10-PEX12) is essential for initiating meiosis, independent of its role in peroxisomal protein import .

Interactions with Other Peroxins

  • PEX5/PEX7: While PEX5 and PEX7 are dispensable for meiotic commitment, they regulate ascospore differentiation and mitochondrial morphology .

  • PEX13: PEX2 deletion elevates PEX13 levels, suggesting feedback regulation between the RING complex and docking machinery .

Future Directions

  • Therapeutic Relevance: Human PEX2 mutations cause Zellweger spectrum disorders; studying the fungal homolog could inform therapeutic strategies .

  • Dynamic Imaging: Live-cell tracking of recombinant PEX2 in P. anserina to map peroxisome-mitochondria interactions during meiosis .

  • Structural Biology: Cryo-EM studies to resolve the RING-finger complex’s architecture and ubiquitination mechanisms .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your request when placing the order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of your preferred tag.
Synonyms
PEX2; CAR1; Peroxisomal biogenesis factor 2; Peroxin-2; Peroxisomal protein CAR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-554
Protein Length
full length protein
Species
Podospora anserina (Pleurage anserina)
Target Names
PEX2
Target Protein Sequence
MSDSKPPKDSSSPSAAVPDVAAAAASSTPTPAPVAITPPSNPQSAHSFAQAQQRLIARRQ TRDAQEAARVAAQQSESQLRARIAASQSPLLRRLGASTLSLWDTISSREGTRPAFRVGQV DAELLDEELVELMKGQVGEAVRYYGGGGGGDNNIKHEWDAEISLALRAVIFKLTIWDHDA TYGAALQNLKYTDARHTGSVLVPPSKWQKGLYGLMTVGGRYMWSKWENWLREQDGGYDEP SPTVQRLSSMTDRLSTLHAAASFASFLVFLLQGRYRTLLDRVLRMRLAPPTSQVSREVSF EYLNRQLVWHAFTEFLLFVLPLVGINRWRRWLARTWRKTKKIMSTTGGEGAEEKKGEFAF LPERTCAICYQDQNQATNENELMAAATSKTGVVGSAQTDVTNPYETIPCGCVYCFVCLAT RIEREEGEGWNCLRCGELVKECKPWSGDVLEHESKSPAQKTVVFADDVKDASDDEQENSQ VLVQQEDDDEYPEEEGEEGGEEEEEEEEGSRSLEDLRTESASEESSEQEADSEGDESEDY EAEEEELGADLDED
Uniprot No.

Target Background

Function
This protein is involved in caryogamy (nuclear fusion), a process essential for sexual sporulation.
Protein Families
Pex2/pex10/pex12 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Peroxisomal biogenesis factor 2 (PEX2) in Podospora anserina?

PEX2 in Podospora anserina functions as an essential component of the peroxisome ubiquitin ligase complex. It participates in the regulation of peroxisomal protein levels through ubiquitination-dependent processes. Specifically, PEX2 works in conjunction with other RING-finger complex proteins (like PEX10 and PEX12) to maintain appropriate levels of peroxisomal membrane proteins such as PEX13. This ubiquitin ligase activity is critical for the recycling of peroxisomal import receptors and the quality control of peroxisomal membrane proteins . Studies have demonstrated that deletion of PEX2 leads to increased levels of PEX13, suggesting that PEX2 plays a role in the constitutive ubiquitination of PEX13, promoting its rapid degradation via the proteasome .

How does PEX2 relate to other peroxins in the peroxisome biogenesis pathway?

PEX2 functions as part of a larger network of peroxisomal proteins (peroxins) that collectively orchestrate peroxisome biogenesis and function. Within this network, PEX2 collaborates closely with PEX10 and PEX12 to form the RING-finger ubiquitin ligase complex that attaches ubiquitin to target peroxisomal proteins . This complex works downstream of the docking complex (containing PEX13 and PEX14) and coordinates with the ubiquitin-conjugating enzyme PEX4. The search results demonstrate that PEX2 functionally interacts with PEX8, which bridges the docking peroxins to the RING-finger complex . Additionally, PEX2 operates in concert with the AAA ATPase complex (PEX1 and PEX6) and the peroxins involved in peroxisome membrane formation (PEX3 and PEX19) to maintain proper peroxisome function .

Why is Podospora anserina used as a model organism for studying peroxisomal proteins?

Podospora anserina serves as an excellent model organism for studying peroxisomal proteins due to several key advantages. This filamentous fungus exhibits a complete sexual cycle with well-defined developmental stages, allowing researchers to investigate the roles of peroxisomes in both vegetative growth and sexual development . The organism's genome is fully sequenced, and it is amenable to genetic manipulations, including targeted gene deletions and protein tagging. Importantly, P. anserina shows distinct phenotypes when peroxisomal functions are disrupted, particularly during sexual development and ascospore germination, making it valuable for studying peroxisome function in developmental contexts . The fungus also demonstrates observable changes in peroxisome dynamics during different life stages, enabling the study of developmental regulation of peroxisomal proteins .

What are the most effective methods for generating and purifying recombinant P. anserina PEX2?

For generating recombinant P. anserina PEX2, researchers typically employ molecular cloning techniques followed by expression in suitable host systems. The recommended methodology includes:

  • PCR amplification of the PEX2 coding sequence from P. anserina genomic DNA or cDNA, using high-fidelity polymerases and primers designed with appropriate restriction sites.

  • Cloning the amplified PEX2 sequence into expression vectors containing appropriate tags (e.g., His-tag, GST-tag) to facilitate purification and detection.

  • Expression in heterologous systems, with E. coli being commonly used for initial studies, though yeast expression systems (S. cerevisiae or P. pastoris) may provide more appropriate post-translational modifications for this eukaryotic protein.

For purification, affinity chromatography based on the incorporated tag is the preferred initial step, followed by size exclusion chromatography to achieve higher purity. When expressing membrane-associated proteins like PEX2, the addition of mild detergents during lysis and purification steps is essential to maintain protein solubility and native conformation. Western blotting with PEX2-specific antibodies should be used to confirm identity and integrity of the purified protein .

How can researchers effectively conduct gene deletion studies of PEX2 in P. anserina?

To conduct effective gene deletion studies of PEX2 in P. anserina, researchers should implement the following methodological approach:

  • Design deletion constructs that replace the PEX2 coding sequence with a selectable marker gene (e.g., hygromycin or phleomycin resistance) flanked by homologous sequences upstream and downstream of the PEX2 gene.

  • Transform P. anserina protoplasts with the deletion construct and select for transformants on appropriate selective media.

  • Confirm gene deletion through PCR analysis using primers that anneal outside the deletion construct, as well as Southern blotting to verify the absence of additional ectopic integrations.

  • Validate the deletion phenotype through functional assays, including:

    • Microscopy to examine peroxisome morphology using fluorescent peroxisomal markers

    • Western blotting to analyze changes in levels of peroxisomal proteins like PEX13

    • Assessment of growth on various carbon sources that require peroxisomal metabolism

    • Examination of sexual development and ascospore germination

  • Complementation analysis by reintroducing the wild-type PEX2 gene to confirm that observed phenotypes are specifically due to PEX2 deletion.

The search results indicate that PEX2 deletion affects PEX13 levels and peroxisome function, which can be observed through fluorescence microscopy and biochemical assays .

How does PEX2 contribute to ascospore germination in P. anserina?

PEX2's contribution to ascospore germination in P. anserina is linked to its role in peroxisome function during sexual development. Based on the search results, we can infer that PEX2, as part of the peroxisome ubiquitin ligase complex, regulates the levels and activity of key peroxisomal proteins involved in ascospore germination pathways .

Wild-type P. anserina ascospores are dormant and require specific stimuli to germinate, typically provided by germination medium supplemented with yeast extract . The GUN mutant screen identified several genes involved in the regulation of ascospore germination, revealing a pathway where peroxisomes play a crucial role. While the search results don't explicitly detail PEX2's direct role in ascospore germination, they indicate that the peroxisomal NADPH oxidase system (PaNox2) is essential for this process, as knockout of PaNox2 blocks ascospore germination .

As part of the peroxisomal machinery, PEX2 likely contributes to the proper localization and function of enzymes involved in ROS production during germination, as the search results mention that ROS (specifically H₂O₂ and O₂⁻) are produced during ascospore germination, suggesting their important role in this process .

What is the relationship between PEX2 activity and the regulation of PEX13 during sexual development in P. anserina?

The relationship between PEX2 activity and PEX13 regulation during sexual development in P. anserina reveals a complex developmental modulation of the peroxisome translocation machinery. Based on the search results, PEX2 (as part of the RING-finger ubiquitin ligase complex with PEX10 and PEX12) is responsible for maintaining low levels of PEX13 in vegetative hyphae through ubiquitin-mediated degradation .

During sexual development, this regulation changes significantly:

  • PEX13 levels naturally increase throughout sexual development, with further elevation during meiocyte and meiotic-spore differentiation .

  • This suggests that PEX2-mediated ubiquitination of PEX13 is developmentally regulated, with reduced PEX2 activity toward PEX13 during sexual development.

  • The regulation appears to involve a selective ubiquitination-dependent removal of PEX13 that modulates its abundance throughout meiotic development and at different sexual differentiation processes .

This developmental regulation of PEX13 via PEX2 is particularly significant because PEX13 is absolutely required for meiosis initiation, unlike some other peroxins . Thus, the modulation of PEX2 activity toward PEX13 appears to be a critical mechanism controlling peroxisome function during the sexual cycle in P. anserina.

How does the ubiquitin ligase activity of PEX2 specifically target different peroxisomal proteins?

The selective targeting of different peroxisomal proteins by PEX2's ubiquitin ligase activity involves a sophisticated molecular recognition system. Based on the search results, the RING-finger complex containing PEX2, PEX10, and PEX12 demonstrates selectivity in ubiquitinating different peroxisomal proteins:

  • Substrate recognition mechanisms: PEX2 likely recognizes specific structural features or post-translational modifications on target proteins. The search results suggest that this recognition often involves additional peroxins acting as adaptors or scaffolds. For example, PEX8 appears to bridge the docking peroxins to the RING-finger complex containing PEX2, potentially facilitating substrate presentation to the ubiquitin ligase .

  • Different ubiquitination modes: The search results indicate that PEX2 participates in both monoubiquitination (for receptor recycling) and polyubiquitination (for protein degradation). These different ubiquitination modes depend on different E2 enzymes: PEX4 for monoubiquitination and Ubc4/Ubc5 for polyubiquitination .

  • Target-specific interactions: The efficiency of PEX2-mediated ubiquitination appears to depend on the target's association with other peroxins. For instance, the search results mention that PEX5 contributes to the association of PEX13 with PEX14, which could influence PEX13's susceptibility to PEX2-mediated ubiquitination .

This complex targeting mechanism ensures proper regulation of peroxisomal protein levels and functionality throughout development and under different physiological conditions.

What are the biochemical differences between PEX2-mediated ubiquitination in vegetative versus reproductive stages of P. anserina?

The biochemical differences in PEX2-mediated ubiquitination between vegetative and reproductive stages of P. anserina reflect developmental reprogramming of peroxisome function. Based on the search results, several key differences can be identified:

Understanding these biochemical differences is crucial for elucidating how P. anserina reprograms peroxisomal functions during its life cycle transitions.

How does PEX2 interact with the PEX5-dependent protein import pathway?

PEX2 interacts with the PEX5-dependent protein import pathway through a complex regulatory network that ensures proper peroxisomal protein import and recycling. Based on the search results, this interaction involves several interconnected mechanisms:

  • Receptor recycling: PEX2, as part of the RING-finger ubiquitin ligase complex, participates in the monoubiquitination of the PEX5 receptor, which is essential for its recycling back to the cytosol after cargo delivery. This process relies on PEX4 as the ubiquitin-conjugating enzyme .

  • Mutual regulation: Interestingly, the search results indicate that PEX5 also influences PEX2 function. Deletion of PEX5 leads to increased levels of PEX13, similar to the effect observed when PEX2 is deleted, suggesting that PEX5 somehow facilitates PEX2-mediated regulation of PEX13 levels .

  • Functional interdependence: The search results mention that "PEX5 could participate (directly and/or indirectly) in handing over PEX13 to the ubiquitination peroxins," indicating that PEX5 may help present substrates to the PEX2-containing ubiquitin ligase complex .

  • Signal transduction: The search results suggest that cargo-loaded versus cargo-unloaded states of PEX5 might signal different events in the peroxisome. Specifically, "Pex5 could signal for Pex13 removal after releasing its cargo in the peroxisome matrix," potentially triggering PEX2-mediated ubiquitination .

This intricate interaction between PEX2 and the PEX5 pathway illustrates how peroxisomal protein import and membrane protein turnover are coordinately regulated.

What is the role of PEX2 in the cross-talk between peroxisomes and mitochondria in P. anserina?

The role of PEX2 in the cross-talk between peroxisomes and mitochondria in P. anserina reveals important organellar communication networks. Based on the search results, several aspects of this interorganellar relationship involving PEX2 can be identified:

  • Regulation of peroxisome-mitochondria associations: The search results indicate that in strains lacking peroxins involved in peroxisome membrane formation (PEX3 and PEX19), PEX13 associates with mitochondria . As PEX2 regulates PEX13 levels, it likely indirectly influences these peroxisome-mitochondria associations.

  • Peroxisome transport system: The search results mention that "several PEX13-labeled peroxisome remnants accumulated at the tip of Δpex10, Δpex12, and Δpex4 hyphae... which could indicate that the peroxisome protein-import and transport systems are related" . This suggests that PEX2 (which works together with PEX10 and PEX12) may influence peroxisome transport, potentially affecting their proximity to mitochondria.

  • Metabolic coordination: While not explicitly detailed in the search results, PEX2's role in maintaining proper peroxisome function likely impacts metabolic pathways that are shared between peroxisomes and mitochondria, such as fatty acid metabolism and ROS homeostasis.

  • Developmental regulation: The search results emphasize that PEX2 function changes during sexual development . This developmental regulation may coordinate peroxisome and mitochondria functions during life cycle transitions, potentially through shared signaling pathways.

Understanding this cross-talk is particularly important as both organelles contribute to cellular redox balance and energy metabolism, which are critical for proper development and sexual reproduction in P. anserina.

What are the main technical challenges in expressing and purifying functional recombinant PEX2?

Expressing and purifying functional recombinant PEX2 from P. anserina presents several technical challenges that require specialized approaches:

  • Membrane protein solubility: PEX2 is a RING-finger domain-containing transmembrane protein that is embedded in the peroxisomal membrane. This hydrophobic nature makes it inherently difficult to maintain in a soluble, properly folded state during expression and purification. Researchers must carefully optimize detergent types and concentrations to extract and stabilize PEX2 without disrupting its native conformation.

  • Maintaining the integrity of the RING-finger domain: The RING-finger domain of PEX2 contains coordinated zinc ions that are essential for its ubiquitin ligase activity. Expression and purification conditions must preserve this metal coordination, potentially requiring the addition of zinc in buffers and avoiding strong reducing agents that might disrupt disulfide bonds.

  • Expression system selection: While bacterial expression systems like E. coli are commonly used for recombinant protein production, they may not provide the appropriate environment for proper folding and post-translational modifications of eukaryotic membrane proteins like PEX2. Yeast expression systems (particularly P. pastoris) may be more suitable, as they provide a eukaryotic environment with peroxisomes.

  • Functional complex formation: As indicated in the search results, PEX2 functions as part of a complex with other RING-finger peroxins (PEX10 and PEX12) . Expressing PEX2 alone might not yield a functionally active protein, potentially requiring co-expression with its complex partners.

To address these challenges, researchers should consider detergent screening, the use of fusion tags that enhance solubility, expression in eukaryotic systems, and validation of function through in vitro ubiquitination assays.

How can researchers effectively visualize PEX2 localization and dynamics in living P. anserina cells?

To effectively visualize PEX2 localization and dynamics in living P. anserina cells, researchers should implement the following methodological approaches:

  • Fluorescent protein tagging: Based on the search results, which describe successful visualization of PEX13-GFP and PEX13-mCherry , researchers can similarly tag PEX2 with fluorescent proteins. The tag should be carefully positioned to minimize interference with PEX2 function, preferably at the C-terminus as the N-terminus contains the RING-finger domain crucial for ubiquitin ligase activity.

  • Verification of fusion protein functionality: Before detailed imaging studies, researchers should verify that the PEX2-FP fusion protein is functional by confirming its ability to complement a PEX2 deletion strain. This ensures that the observed localization reflects that of the native protein.

  • Multi-color imaging approaches: To understand PEX2's relationship with other peroxisomal components, researchers should perform co-localization studies with established peroxisomal markers. The search results describe successful double-labeling approaches with proteins like FOX2-mCherry , which can be adapted for PEX2 studies.

  • Time-lapse microscopy: To capture the dynamics of PEX2 during development, researchers should implement time-lapse imaging throughout vegetative growth and sexual development. The search results indicate significant changes in peroxisome protein levels and distribution during these transitions .

  • Advanced microscopy techniques: Super-resolution microscopy techniques (such as STED or PALM) can provide enhanced spatial resolution to better visualize PEX2 within the peroxisomal membrane. Additionally, techniques like FRAP (Fluorescence Recovery After Photobleaching) can help assess PEX2 mobility within the membrane.

  • Quantitative image analysis: The search results describe quantification of fluorescence intensity levels to compare protein abundance between different strains . Similar approaches should be implemented for PEX2, using standardized imaging conditions and appropriate controls.

These approaches will enable researchers to track PEX2 localization, abundance, and dynamics throughout the P. anserina life cycle.

How does P. anserina PEX2 structure and function compare to PEX2 in other model organisms?

P. anserina PEX2 structure and function share conserved features with PEX2 proteins from other organisms, but also display species-specific characteristics that reflect evolutionary adaptations:

  • Conserved domains and functions: Like PEX2 proteins in other organisms, P. anserina PEX2 contains a RING-finger domain that confers ubiquitin ligase activity. This fundamental function in peroxisomal protein ubiquitination appears conserved across species, including yeasts like Hansenula polymorpha and Saccharomyces cerevisiae, as well as human cells .

  • Species-specific regulatory mechanisms: The search results indicate that while PEX2-mediated regulation of PEX13 levels occurs in both P. anserina and H. polymorpha, there are quantitative differences in how PEX4 deletion affects this regulation. In H. polymorpha, PEX13 increase in pex4 cells was much lower than in cells defective for the ubiquitin ligase complex, whereas in P. anserina, the effects were similar .

  • Developmental regulation: A distinctive feature of P. anserina PEX2 appears to be its involvement in the developmental regulation of peroxisome function during sexual reproduction. The search results emphasize that "PEX13 is differently regulated in the somatic and sexual phases of the life cycle and that it is also differentially regulated throughout meiotic development" . This developmental aspect may be particularly elaborated in P. anserina compared to unicellular yeasts.

  • Interaction networks: While the core interactions with other RING-finger complex components (PEX10, PEX12) are conserved, the broader interaction network may show species-specific adaptations. For instance, the search results mention interactions with PEX5 in regulating PEX13 levels that may reflect specific adaptations in P. anserina .

This comparative perspective highlights how a conserved peroxisomal protein has been adapted to support the complex life cycle of a multicellular filamentous fungus.

What insights does P. anserina PEX2 research provide for understanding peroxisomal disorders in humans?

Research on P. anserina PEX2 provides valuable insights for understanding human peroxisomal disorders through several translational connections:

  • Conserved ubiquitination mechanisms: The search results indicate that PEX2-mediated ubiquitination of peroxisomal proteins is conserved from fungi to humans . In human cells, Pex2 depletion leads to increased Pex13 levels, similar to the effect observed in P. anserina, suggesting shared regulatory mechanisms . This conservation supports the use of P. anserina as a model for studying fundamental aspects of peroxisome biology relevant to human diseases.

  • Developmental regulation of peroxisome function: P. anserina research has revealed complex developmental regulation of peroxisomal proteins during sexual reproduction . While the specific sexual cycle differs from human development, the principles of developmental reprogramming of peroxisome function may be relevant to understanding tissue-specific manifestations of peroxisomal disorders in humans.

  • Peroxisome-mitochondria cross-talk: The search results mention associations between peroxisomes and mitochondria in P. anserina . This interorganellar communication is increasingly recognized as important in human health and disease, with disruptions contributing to neurodegenerative and metabolic disorders. P. anserina provides a tractable model to study these interactions.

  • Protein quality control mechanisms: The research on PEX2-mediated regulation of peroxisomal proteins in P. anserina illuminates protein quality control mechanisms in peroxisomes . In humans, defects in peroxisomal protein quality control contribute to peroxisome biogenesis disorders (Zellweger spectrum disorders), where mutations in PEX2 are among the causative factors.

By elucidating these fundamental mechanisms in a genetically tractable model organism, P. anserina PEX2 research contributes to our understanding of the molecular basis of human peroxisomal disorders and potentially identifies new therapeutic targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.