Recombinant Podospora anserina Protein GET1 (GET1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GET1; Pa_3_7110; PODANS_3_7110; Protein GET1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina)
Target Names
GET1
Target Protein Sequence
MPSLLLIIFVTELVVQLVNTLGATTINDLLWRIYLTLPTPLSLEFAQQRRKQKEYLAVRH ELKATSSQDEFAKWAKLRRQHDKLLEDLEKKKASLEAARTKFDRTLTTTRTVSTRSVQWF LPFWYSKEPMFWLPYGWFPYYVEWFASFPRAPMGSVSIVVWQWACTAVIALMIEAATAAL VYVAAKQSQKIRQPVPAQSEKKDS
Uniprot No.

Target Background

Function

Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. It functions as a membrane receptor for soluble GET3, which specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol.

Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Podospora anserina GET1 protein and what is its biological function?

Podospora anserina GET1 (B2B0S1) is a 204-amino acid protein involved in the guided entry of tail-anchored proteins pathway. The protein functions as part of the GET complex that facilitates the post-translational insertion of tail-anchored proteins into the endoplasmic reticulum membrane. GET1 is characterized as a membrane protein with multiple transmembrane domains, consistent with its role in membrane protein insertion machinery .

In P. anserina, a model organism for studying fungal biology, GET1 likely plays crucial roles in cellular processes including protein trafficking and membrane organization. While not directly involved in the heterokaryon incompatibility systems that have been extensively studied in P. anserina, it represents an important component of the cellular machinery maintaining proper protein localization .

What are the optimal storage and handling conditions for recombinant GET1 protein?

The recombinant P. anserina GET1 protein should be stored at -20°C/-80°C upon receipt, with aliquoting recommended for multiple use scenarios. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity .

For long-term storage, reconstituted protein should be supplemented with glycerol (5-50% final concentration, with 50% being standard) before aliquoting and freezing. The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during lyophilization and storage .

How should recombinant GET1 protein be reconstituted for experimental use?

For reconstitution of lyophilized GET1 protein:

  • Briefly centrifuge the vial prior to opening to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50%) for storage

  • Aliquot to minimize freeze-thaw cycles

  • Store at -20°C/-80°C for long-term use

When preparing working solutions, the buffer composition should be optimized based on the specific experimental requirements. For membrane protein studies, consider including mild detergents to maintain protein solubility while preserving native conformation.

What experimental approaches can verify GET1 functionality in vitro?

To verify the functionality of recombinant P. anserina GET1 protein, researchers can implement several complementary approaches:

  • Membrane Insertion Assays: Reconstitute GET1 into liposomes along with GET2 to create a minimal insertion machinery. Using fluorescently labeled tail-anchored protein substrates, monitor insertion efficiency through protease protection assays or changes in fluorescence properties.

  • Co-immunoprecipitation Studies: Use anti-His antibodies to pull down His-tagged GET1 and analyze co-precipitating partners to verify interaction with other GET pathway components.

  • Surface Plasmon Resonance: Measure direct binding kinetics between GET1 and its known interaction partners (GET2, GET3-tail-anchored protein complexes).

  • Complementation Assays: Express P. anserina GET1 in yeast GET1 deletion strains to test functional conservation through rescue of growth phenotypes associated with defective tail-anchored protein insertion.

For these assays, the recombinant protein must be properly reconstituted in a suitable detergent or membrane environment to maintain its native conformation and activity .

What experimental challenges are associated with studying membrane proteins like GET1?

Working with membrane proteins such as GET1 presents several methodological challenges:

  • Solubility and Stability: Maintaining proper folding and stability outside their native membrane environment requires careful optimization of detergents or reconstitution into membrane mimetics.

  • Purification Efficiency: Extraction from expression systems often yields lower quantities compared to soluble proteins. Standard recommendation for recombinant GET1 includes expression in E. coli with specific protocols to maximize yield .

  • Activity Assessment: Verifying functional activity requires specialized assays that recreate the membrane environment.

  • Structural Studies: Traditional structural biology techniques require additional optimization for membrane proteins.

Recommended approaches to address these challenges:

  • Use mild, non-ionic detergents during purification

  • Consider nanodiscs or liposomes for functional studies

  • Employ negative stain electron microscopy for initial structural characterization

  • For higher resolution studies, consider cryo-EM rather than crystallography

  • Validate proper folding using circular dichroism or limited proteolysis

How can researchers design experiments to investigate GET1's role in tail-anchored protein insertion?

To investigate GET1's role in tail-anchored protein insertion in P. anserina, researchers should consider a multi-faceted experimental design:

  • Gene Deletion/Silencing Studies:

    • Generate GET1 knockout strains in P. anserina

    • Characterize phenotypes related to protein mislocalization

    • Create conditional expression systems to study essential functions

  • Protein-Protein Interaction Mapping:

    • Perform yeast two-hybrid or split-ubiquitin assays to identify interaction partners

    • Conduct co-immunoprecipitation followed by mass spectrometry

    • Use proximity labeling approaches (BioID, APEX) to identify proximal proteins in vivo

  • Substrate Specificity Analysis:

    • Identify tail-anchored proteins in P. anserina through bioinformatic prediction

    • Track their localization in GET1 mutant backgrounds

    • Develop in vitro reconstitution systems using purified components

  • Structural Studies:

    • Use the recombinant GET1 protein for structural determination

    • Perform mutagenesis of key residues to map functional domains

    • Develop fluorescently tagged versions for localization studies

What is known about the regulation of GET1 expression and function in fungal systems?

While the provided search results don't specifically address GET1 regulation in P. anserina, researchers can explore several regulatory aspects based on knowledge of related systems:

  • Transcriptional Regulation: Investigate whether GET1 expression changes during different developmental stages or stress conditions in P. anserina. This can be addressed through:

    • qRT-PCR analysis across developmental stages

    • RNA-seq data mining from existing P. anserina datasets

    • Promoter analysis for regulatory elements

  • Post-translational Modifications:

    • Phosphoproteomic analysis to identify regulatory modifications

    • Site-directed mutagenesis of putative modification sites to assess functional consequences

    • Comparison with known modifications in homologs from other fungi

  • Protein Turnover and Stability:

    • Pulse-chase experiments to determine protein half-life

    • Analysis of degradation pathways (proteasomal vs. lysosomal)

    • Identification of quality control mechanisms for membrane protein assembly

Unlike P. anserina het genes that show complex patterns of balancing selection , housekeeping genes like GET1 likely show different evolutionary patterns governed by purifying selection, reflecting their conserved cellular functions.

What are the best expression systems for producing functional recombinant GET1 protein?

The optimal expression system depends on research objectives and downstream applications:

  • E. coli Expression (currently used for commercial recombinant GET1 ):

    • Advantages: High yield, simplicity, cost-effectiveness

    • Challenges: Membrane protein folding may be suboptimal

    • Optimization strategies: Use specialized strains (C41/C43), lower induction temperature, fusion tags

  • Yeast Expression Systems:

    • Advantages: Eukaryotic folding machinery, post-translational modifications

    • Recommended for: Functional studies requiring native-like protein

    • Systems: S. cerevisiae or P. pastoris with inducible promoters

  • Baculovirus-Insect Cell System:

    • Advantages: Higher-order eukaryotic system, good for complex proteins

    • Appropriate for: Structural studies requiring higher quality protein

    • Considerations: Higher cost, longer development time

  • Cell-Free Expression:

    • Advantages: Rapid, adaptable for membrane proteins with supplied detergents/lipids

    • Applications: Initial screening, incorporation of unnatural amino acids

    • Limitations: Typically lower yields than cellular systems

For functional studies of P. anserina GET1, a systematic comparison of these expression systems would provide valuable methodological guidance for the research community.

How can researchers integrate GET1 studies with broader investigations of protein trafficking in P. anserina?

To place GET1 research within the broader context of protein trafficking in P. anserina:

  • Systems Biology Approaches:

    • Construct protein-protein interaction networks centered on GET pathway components

    • Perform comparative genomic analysis across fungi to identify conserved and divergent aspects

    • Integrate transcriptomic and proteomic data to identify co-regulated genes

  • Cellular Imaging Techniques:

    • Develop fluorescent protein fusions to visualize GET1 localization and dynamics

    • Use super-resolution microscopy to examine co-localization with other trafficking components

    • Employ live-cell imaging to track protein movement in real-time

  • Genetic Interaction Mapping:

    • Perform synthetic genetic array analysis with GET1 and other trafficking genes

    • Identify suppressors and enhancers of GET1 deletion phenotypes

    • Create double mutants with components of related pathways

Unlike the extensively studied allorecognition systems in P. anserina , protein trafficking pathways have received less attention in this organism despite their fundamental importance, making this an area ripe for investigation.

What analytical techniques are most effective for studying GET1 interactions with tail-anchored proteins?

Several analytical techniques are particularly effective for studying GET1-substrate interactions:

  • Microscale Thermophoresis (MST):

    • Measures interactions in solution with minimal sample consumption

    • Can detect binding affinity changes under varying conditions

    • Requires fluorescent labeling of one interaction partner

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps interaction interfaces at peptide-level resolution

    • Identifies conformational changes upon complex formation

    • Works well with membrane proteins in detergent environments

  • Crosslinking Mass Spectrometry:

    • Captures transient interactions through covalent bonds

    • Identifies specific residues involved in protein-protein contacts

    • Can be performed in native or reconstituted systems

  • Single-Molecule FRET:

    • Monitors dynamic interactions in real-time

    • Resolves conformational changes during the insertion process

    • Provides kinetic information about intermediate states

When using recombinant His-tagged GET1 protein , researchers should verify that the tag does not interfere with interactions through appropriate control experiments.

How might GET1 function relate to P. anserina's life cycle and cellular differentiation?

While the search results don't directly address GET1's role in P. anserina development, researchers can explore several hypotheses:

  • Developmental Regulation:

    • Examine GET1 expression profiles during different developmental stages (vegetative growth, sexual reproduction, aging)

    • Determine if GET1 function is essential during specific life cycle transitions

    • Compare with expression patterns of identified tail-anchored protein substrates

  • Relevance to Hyphal Growth:

    • Investigate the role of GET1 in polarized growth and membrane organization at hyphal tips

    • Examine potential connections to the spitzenkörper organization and function

    • Test whether GET1 mutants exhibit altered hyphal morphology or extension rates

  • Connections to Allorecognition:

    • Although GET1 is not directly involved in heterokaryon incompatibility systems well-characterized in P. anserina , investigate whether proper membrane protein trafficking impacts allorecognition outcomes

    • Test genetic interactions between GET pathway components and het genes

A comprehensive analysis combining transcriptomics, proteomics, and cell biology approaches would significantly advance understanding of GET1's broader biological roles.

How can comparative studies between P. anserina GET1 and homologs inform evolutionary understanding of the GET pathway?

Comparative studies offer several avenues for evolutionary insight:

  • Phylogenetic Analysis:

    • Construct phylogenetic trees of GET pathway components across fungi

    • Map functional diversification of the pathway onto fungal evolutionary history

    • Identify lineage-specific adaptations and conserved core functions

  • Comparative Genomics:

    • Analyze synteny and gene neighborhood patterns

    • Examine whether GET1 shows evidence of selection pressures similar to those observed in het genes (balancing selection, trans-species polymorphism)

    • Identify co-evolution patterns with interacting partners

  • Experimental Evolution:

    • Subject P. anserina to various selection pressures and track GET pathway adaptations

    • Test functional consequences of naturally occurring GET1 variants

    • Perform directed evolution experiments to identify potential alternate functions

Unlike the het genes in P. anserina that show clear evidence of balancing selection and trans-species polymorphism , essential genes like GET1 likely show different evolutionary patterns that could provide complementary insights into fungal adaptation.

What are the most promising directions for future GET1 research in filamentous fungi?

Based on current knowledge gaps, several research directions appear particularly promising:

  • Structural Biology:

    • Determine high-resolution structures of fungal GET complexes

    • Compare structural features across fungal lineages

    • Map the conformational changes during the tail-anchored protein insertion cycle

  • Substrate Specificity:

    • Comprehensively identify the full complement of tail-anchored proteins in P. anserina

    • Determine whether fungal-specific tail-anchored proteins exist

    • Investigate whether alternative insertion pathways complement GET function

  • Integration with Cellular Stress Responses:

    • Examine GET1 function during ER stress conditions

    • Investigate connections to unfolded protein response pathways

    • Test whether GET pathway capacity affects cellular resilience to environmental challenges

  • Biotechnological Applications:

    • Explore the utility of the GET pathway for improved heterologous expression of challenging membrane proteins

    • Develop GET-based tools for membrane protein engineering

    • Investigate whether GET pathway manipulation could enhance industrial fungal strains

The recombinant P. anserina GET1 protein provides an essential tool for many of these investigations , enabling both in vitro reconstitution studies and the development of biochemical assays.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.